KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_0897Help
Entry
Ornrh_0897        CDS       T02145                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ornrh_0897
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ornrh_0897
Exosome [BR:orh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ornrh_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
937508..938488
Genome map
AA seq 326 aa AA seqDB search
MYPYQRNRRTRSNEAIRNIVRETSLSTHDLMLPLFIMEGENLREEIPSMPGVYRITLDVL
EKEIQEIWDLGIQAVNIYCKVPDELKDNEGTEALNPNGLMQRAIKTIKKAQKDMLVFTDV
ALDPVSSYGHDGIVENGEILNDETVEILAKMALSHAEAGADFIAPSDMMDGRVLAIREIL
EQNGFHNVGIMSYTAKYASSFYGPFRDALDSAPGFGDKKTYQMDYANVQEAYREADNDLI
EGADILMVKPGMPYLDVLYRMKEYTKMPIAVYQVSGEYAMLKAAAEKGWLDFEKCLMESM
YAFKRAGADLINTYYAKEVATILNRK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatcaaagaaatagaagaactcgtagcaacgaggcgattagaaatatcgta
agagaaacaagcctaagcacccatgatttaatgctgccgcttttcatcatggagggcgag
aatttaagagaagaaatccctagcatgccaggcgtttatagaataacgctcgatgtgctg
gaaaaagaaatccaagaaatttgggatttgggcattcaagccgtaaacatctactgcaaa
gtgccagatgagctcaaagacaacgagggtaccgaggctctaaaccctaatggattgatg
caacgcgccatcaaaaccattaaaaaagcgcaaaaagatatgctcgtgtttaccgatgtg
gcacttgaccctgtctcctcttacgggcacgacggaattgtggaaaatggcgaaatctta
aacgacgaaacggtagaaattttagctaaaatggcactttcgcacgccgaagctggagcc
gatttcattgccccgtccgacatgatggatggtcgcgttttagccattcgtgaaatttta
gaacaaaacggattccacaatgtaggtatcatgagctacacggcaaaatacgccagctca
ttctatgggccgttccgagatgcgctcgattctgcaccaggatttggcgataaaaaaacc
taccaaatggattatgccaatgtgcaagaagcctaccgcgaggcagataatgacttaatc
gagggggcagacatcttgatggtgaaaccaggcatgccctacctagatgtgctttatcgc
atgaaagaatataccaaaatgccaattgccgtgtaccaagtaagtggcgaatatgccatg
ctgaaagctgccgcagaaaaaggctggctcgattttgaaaaatgcttaatggaatccatg
tatgcattcaaacgcgcgggtgcagatttaatcaacacctattatgccaaagaagtggct
actattttgaatagaaaatag

DBGET integrated database retrieval system