KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1079Help
Entry
Ornrh_1079        CDS       T02145                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Ornrh_1079
Enzymes [BR:orh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Ornrh_1079
    3.5.1.-  
     Ornrh_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1128851..1129450
Genome map
AA seq 199 aa AA seqDB search
MKTLLIVDVQNDFMPYGALPVAKGDEVVPYINQIIESYDLVVATQDWHPANHKSFAAEHD
GKNPFDVIDLNGIQQVLWPTHCVQATEGAEFHPDLNAKPIEVVFRKGMNPEVDSYSAFFD
NDKKYATQLSGFLKAKGVKEIDVVGLAADYCVFYSVQDALREGFKVNLHLKGTRAIDPKN
FEENILKELNQNPNFKSIS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacttttaatcgtagatgttcaaaacgactttatgccatacggagccttgcct
gtggctaagggcgatgaggtggtgccttacatcaaccaaattatagaatcttatgatttg
gtggtggcaacgcaagattggcaccctgcaaaccataaaagttttgcagcagagcatgac
gggaaaaatccgtttgatgtcattgatttaaatggcattcagcaagttttgtggcctacg
cattgcgtgcaagcaacagagggggcggagtttcatccagatttaaatgccaagccgatt
gaagtcgttttcagaaaaggaatgaatcccgaagtggacagctattcagcttttttcgac
aatgataaaaaatatgccacacagctttcaggttttttgaaggctaaaggcgttaaggag
atagatgtcgtgggcttggcggcagattattgtgtgttttattctgtgcaagatgctttg
agagaaggttttaaagttaatttgcatttaaaggggacgcgtgccattgatcccaaaaat
tttgaagaaaatattttgaaggaattaaaccaaaatccaaattttaaaagtatttcttaa

DBGET integrated database retrieval system