KEGG   Ornithobacterium rhinotracheale: Ornrh_1268Help
Entry
Ornrh_1268        CDS       T02145                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ornrh_1268
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ornrh_1268
  Amino acid metabolism
   00310 Lysine degradation
    Ornrh_1268
Enzymes [BR:orh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ornrh_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1289485..1290717
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVKDGDYVEKDQPIAEVDSDKATLELPAEESGVITLK
AEEGDTVEVGQVVCLIDRDASKPAGTKSEEKKETKAEEKPKEEAPKVEEKKETYATGTAS
PAAKKILAEKNIDPKEIKGTGKDGRITKADAEQYVPAMGSAPSYANRGTERKKLSSLRRK
LAQRLVSAKNETAMLTTFNEVDMTAIFEIRKKYKDEFKEKHGVGLGFMSFFTKAVVRALQ
MYPDVNSMIDGDYKVSYDFMDISIAVSGPKGLMVPVVRSAEMLTFRGIEQNIKDLAIKVR
DGKITIDEMTGGTFTITNGGVFGSMMSTPIINPPQSAILGMHNIVERPVVKNGGIAIAPM
MYVALSYDHRIIDGRESVGFLVAVKEAVENPAELLMGGTSDAEIRRALEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttagaaatgaaagttccttctccaggggaatcgataactgaagtagaaata
gctacttggcttgtaaaagatggcgactatgtagaaaaagatcagcccatcgcagaagta
gattcagacaaagctacgctagaacttcctgccgaagaaagtggagtaattacgctaaaa
gcagaagaaggggacaccgttgaggtggggcaagtcgtttgcttaatcgatcgtgatgca
agcaaaccagcaggcactaaatctgaggagaaaaaagaaaccaaagcagaagaaaaacca
aaagaggaagctccaaaagtagaagagaaaaaagaaacttatgcaacgggaactgcttcg
ccagcagcaaaaaagattttggctgagaaaaatatcgatccaaaagaaataaaaggaaca
ggcaaagatggtagaattaccaaagccgatgcagaacaatatgtgcctgccatgggaagt
gctccatcgtatgcaaatcgtggtaccgagcgcaaaaaactttcttctttgcgtagaaaa
ttagcacagagattggtaagtgccaaaaacgagacagcaatgcttactaccttcaacgag
gtggatatgaccgctatttttgaaattagaaaaaaatacaaggacgaatttaaagaaaaa
cacggcgtaggtttaggctttatgtctttctttaccaaagccgtagtgcgtgcattgcaa
atgtatccagatgtaaactctatgattgatggagattacaaagtgtcgtatgactttatg
gatatttcgattgctgtttcagggccaaaaggattgatggtgcccgtagtacgcagtgca
gaaatgctcacattcagaggaattgaacaaaatattaaagatttagccattaaagtaaga
gatggaaaaatcacgattgatgagatgactggcggaacattcaccattaccaatggtgga
gtattcggttctatgatgtctacacctatcatcaatccgccacaatcggcaattttagga
atgcacaacatcgttgagcgtcccgtagtgaaaaacggaggaatcgccattgcaccgatg
atgtatgtagccctttcatacgaccacagaatcatcgacggtagagaatccgtaggtttc
ttggtggcagtgaaagaagctgtggaaaatcctgctgaattgcttatgggaggaacttct
gatgcagaaatcagaagagcacttgagctttaa

DBGET integrated database retrieval system