KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1268Help
Entry
Ornrh_1268        CDS       T02145                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00020  Citrate cycle (TCA cycle)
orh00310  Lysine degradation
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01120  Microbial metabolism in diverse environments
orh01130  Biosynthesis of antibiotics
orh01200  Carbon metabolism
Module
orh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
orh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ornrh_1268
  Amino acid metabolism
   00310 Lysine degradation
    Ornrh_1268
Enzymes [BR:orh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ornrh_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFL97450
UniProt: I4A0G6
Position
1289485..1290717
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVKDGDYVEKDQPIAEVDSDKATLELPAEESGVITLK
AEEGDTVEVGQVVCLIDRDASKPAGTKSEEKKETKAEEKPKEEAPKVEEKKETYATGTAS
PAAKKILAEKNIDPKEIKGTGKDGRITKADAEQYVPAMGSAPSYANRGTERKKLSSLRRK
LAQRLVSAKNETAMLTTFNEVDMTAIFEIRKKYKDEFKEKHGVGLGFMSFFTKAVVRALQ
MYPDVNSMIDGDYKVSYDFMDISIAVSGPKGLMVPVVRSAEMLTFRGIEQNIKDLAIKVR
DGKITIDEMTGGTFTITNGGVFGSMMSTPIINPPQSAILGMHNIVERPVVKNGGIAIAPM
MYVALSYDHRIIDGRESVGFLVAVKEAVENPAELLMGGTSDAEIRRALEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttagaaatgaaagttccttctccaggggaatcgataactgaagtagaaata
gctacttggcttgtaaaagatggcgactatgtagaaaaagatcagcccatcgcagaagta
gattcagacaaagctacgctagaacttcctgccgaagaaagtggagtaattacgctaaaa
gcagaagaaggggacaccgttgaggtggggcaagtcgtttgcttaatcgatcgtgatgca
agcaaaccagcaggcactaaatctgaggagaaaaaagaaaccaaagcagaagaaaaacca
aaagaggaagctccaaaagtagaagagaaaaaagaaacttatgcaacgggaactgcttcg
ccagcagcaaaaaagattttggctgagaaaaatatcgatccaaaagaaataaaaggaaca
ggcaaagatggtagaattaccaaagccgatgcagaacaatatgtgcctgccatgggaagt
gctccatcgtatgcaaatcgtggtaccgagcgcaaaaaactttcttctttgcgtagaaaa
ttagcacagagattggtaagtgccaaaaacgagacagcaatgcttactaccttcaacgag
gtggatatgaccgctatttttgaaattagaaaaaaatacaaggacgaatttaaagaaaaa
cacggcgtaggtttaggctttatgtctttctttaccaaagccgtagtgcgtgcattgcaa
atgtatccagatgtaaactctatgattgatggagattacaaagtgtcgtatgactttatg
gatatttcgattgctgtttcagggccaaaaggattgatggtgcccgtagtacgcagtgca
gaaatgctcacattcagaggaattgaacaaaatattaaagatttagccattaaagtaaga
gatggaaaaatcacgattgatgagatgactggcggaacattcaccattaccaatggtgga
gtattcggttctatgatgtctacacctatcatcaatccgccacaatcggcaattttagga
atgcacaacatcgttgagcgtcccgtagtgaaaaacggaggaatcgccattgcaccgatg
atgtatgtagccctttcatacgaccacagaatcatcgacggtagagaatccgtaggtttc
ttggtggcagtgaaagaagctgtggaaaatcctgctgaattgcttatgggaggaacttct
gatgcagaaatcagaagagcacttgagctttaa

DBGET integrated database retrieval system