KEGG   Ornithobacterium rhinotracheale: Ornrh_1408Help
Entry
Ornrh_1408        CDS       T02145                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:orh00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:orh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1439900..1441222)
Genome map
AA seq 440 aa AA seqDB search
MAIFEINGGKRLHGEITPQGAKNEALQILCATLLTDEPVRIKNLPDIRDVNRLIEILKNL
NVRVEKNGKGDFTFHAKNINLAYLKSPEFKADGAALRGSVMLMGPLLARFGFAYMPKPGG
DKIGRRRLDTHFQGFIELGAQYNFHKNEDFYTLEIPKGKNLKGTYMLLEEASVTGTANIV
LAAVLAEGTTTIYNAACEPYIQQLCTMLVNMGAKIEGIKSNLLTITGVEKLHGTEHTCLP
DMIEIGSWIGLAAMTKSELTIKNVGWEHLGIIPDVFRKLGIQLEKQGDDIYIPAQENYKI
QHFMDGSILTVADAPWPGFTPDLLSIILVVATQAKGSVLVHQKMFESRLFFVDKLIDMGA
QIILCDPHRATVIGLNHETELRGTNMSSPDIRAGIALLIAAVAAQGKSIIHNIDQIDRGY
EDIEKRLRAIGVDIKRVEEN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctatatttgaaattaatggtggaaaaagactccacggagaaatcactccgcaaggt
gccaaaaacgaagccttacaaattttatgtgcaacgctcctaaccgatgagcctgttcgt
atcaaaaatttgccagacattcgtgatgtaaaccgcttaatagaaattcttaaaaatcta
aatgttcgtgtagaaaaaaacggaaaaggcgattttacattccatgccaaaaacattaat
ttagcctatcttaaatctcctgaatttaaggcagatggtgcagcactcagaggctctgtg
atgcttatgggaccactgctcgctcgttttggttttgcttatatgcctaaacctgggggc
gacaaaattggacgccgaagactggatacccactttcaaggctttattgaactaggggct
cagtataatttccataaaaacgaggatttttacaccttagaaattcctaaaggcaaaaac
ctaaaaggtacttacatgcttttggaagaagcatcggttacaggaactgccaacattgtt
ttagccgcagttttagctgaaggcaccacaacgatttacaacgcagcttgcgagccatac
attcagcaattgtgtaccatgcttgtgaatatgggagctaaaatcgagggaataaaatct
aacctactcaccattacaggcgtagaaaaactccacggaaccgagcatacttgcttgcca
gatatgattgaaattggtagctggattggtctcgcagcaatgactaaatcggaactcaca
atcaaaaatgtgggctgggaacatctaggcattatcccagatgtgtttagaaaattggga
attcaactagagaagcaaggcgatgatatttatattcctgcacaggaaaattataaaatt
cagcattttatggacggctctatcctcaccgttgccgatgctccgtggccaggattcacg
cccgatttgttgagcattattttggtggtggctacacaggctaaaggtagcgtactcgtt
caccaaaaaatgtttgaaagtagactcttcttcgtagataaattaatcgacatgggggcg
caaatcattctctgcgacccacaccgcgcaacagttattgggcttaatcacgagactgaa
ttgcgaggcaccaatatgtcttcgccagacatccgtgcggggattgcacttctaattgct
gccgtggcagctcaagggaaaagtatcattcacaacatcgaccaaatcgatcgtggctac
gaagacatcgaaaaacgattgagagccataggtgtagacatcaagcgtgtggaagaaaac
taa

DBGET integrated database retrieval system