KEGG   Ornithobacterium rhinotracheale: Ornrh_1445Help
Entry
Ornrh_1445        CDS       T02145                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
orh  Ornithobacterium rhinotracheale
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Ornrh_1445
Enzymes [BR:orh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Ornrh_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1481341..1482927)
Genome map
AA seq 528 aa AA seqDB search
MERRKFLELTGLGASALLASSTLSACRVLNLAPNRTKKVGHFPNIIVGSGYGGAVCARRL
TENKQPVLILEMGKRWDRTPKHDTFCKMIKADKRSSWFSNWPNAPIPIPIPIKKYPGVLD
KIKYDEMDIFAGRAYGGGSIVNGGISIPPRRDYFKEIFPQIDDKEMYDVFFPLANKELKV
QRIPEKFYDTTEYYNFSRSAEKQAHNAGLKTQFFSNTYDFDYMQLEAKGEVYKSALGGEV
IYGNNAGKFSLDQTYLKKAEETGLVSLRTMRMLDKIIANEDGTYTLEVKVIKENGDVDVL
EIYTCDKLFLNAGSTGTSEVLLKSKYLGGLPNLNEELGQHWGPNGNIMTGRNFVNSTGVN
QSTIPVKGIDMWNGDFEYKIFAEIAPLPLGIETWTTLFLSISDNRERGNYYFDKASKKVK
LNWKRSQNEYSVKAAKLLLKKLKEDNGGTRSRLLFNNGFGDDFCYHPLGGCVLGKATDDF
GRVHGYKNLYVQDSSLIPGSAGVNPFVFITALAERNMATIAKEDFKQI
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaagaaaatttttagaattaacaggtttaggtgcctctgccttgttggcaagc
agcacactgagtgcatgtagagttttaaatcttgctccaaacagaactaaaaaagtggga
cattttcccaacatcatcgtggggagtggctacggtggggctgtgtgtgcgaggagatta
accgagaacaagcaacctgtgttaattctagaaatgggaaaacgctgggacagaacgcct
aagcacgatactttttgtaaaatgattaaggcagataaacgctctagctggttttctaat
tggccaaatgctccaattcctatcccgatcccgataaaaaaatatccaggagttttagat
aaaataaaatatgacgaaatggatatttttgcagggcgtgcctatggtggtggttccatt
gtgaacggaggaatatctattccgccaaggagagattattttaaagagattttcccgcaa
atcgatgataaggaaatgtatgatgtcttcttcccacttgccaataaggaattaaaagtg
caaagaattccagaaaaattctatgacacaacggaatattataatttctcgcgctctgcc
gaaaaacaagcacacaatgcaggattaaaaacacaattctttagcaacacctacgacttt
gattacatgcaacttgaagccaagggcgaggtttacaaatctgctttaggaggagaagta
atttatggaaacaatgctggaaaattcagcttagaccaaacttatcttaaaaaagcggaa
gaaactggacttgtttcgctcagaacgatgcgaatgctcgacaaaatcattgccaacgaa
gatggaacttacacactagaggtgaaagtgattaaagagaatggcgatgtagatgtactc
gaaatttatacttgcgacaaattattcctcaacgcgggtagcacaggaacttctgaggtt
ttgcttaaatctaaatatttaggtggcttgccaaatttaaacgaagaacttgggcaacat
tggggacccaacggaaatatcatgacagggcgaaactttgtaaatagcacgggcgtgaac
caatcaactattccagtgaaagggattgatatgtggaatggcgattttgaatacaaaatt
tttgctgaaattgcaccgcttcctttaggcattgaaacttggactacgctattcctctct
atttcagacaaccgagagcgtggaaactactattttgacaaagcaagtaaaaaggtaaaa
ctgaactggaaaagatctcaaaacgaatattctgtaaaagcagccaaacttttactcaaa
aaactgaaagaagacaacggcggaactcgttcgcgattgttgtttaataatggatttgga
gatgatttctgctaccacccacttggcggttgcgtgctaggcaaagctaccgatgatttt
ggtcgtgtgcatgggtacaaaaatctgtatgtgcaagacagctcactcattccagggagt
gcgggcgtaaatccttttgtgtttatcaccgccttggcagagcgaaatatggcaaccatt
gcgaaagaagattttaaacaaatttaa

DBGET integrated database retrieval system