KEGG   Ornithobacterium rhinotracheale: Ornrh_1464Help
Entry
Ornrh_1464        CDS       T02145                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:orh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ornrh_1464
DNA repair and recombination proteins [BR:orh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ornrh_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1500415..1501020)
Genome map
AA seq 201 aa AA seqDB search
MHYPSKILEQAVEEISQLPGIGKRTALRLALHMLQRPKSQTHVLAQSMTKLVDEIQYCKQ
CYALCDNDICEICENQLREQDIICVVEDIRDVMAIENTGQYRGVYHVLGGKISPMEGIGP
EKLNIVPLLERAKNAKEIIFAMSSTMEGDTTVFYLYKLLKDSDVKLSTIARGIGVGDELE
YADELTLGRSITHRVPYEDNL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcactatcctagcaaaattttggaacaagcagtagaagaaatctctcaactaccagga
attgggaagcgcacggctttgcgtttagccttgcatatgttgcaacgccccaaaagccaa
acacatgttttggcacaatcgatgacgaaattggtagacgaaattcaatattgcaaacaa
tgctatgcactgtgcgacaacgatatttgcgaaatctgtgaaaatcaattgcgtgagcaa
gacattatttgcgttgtagaagacatccgtgatgtgatggcgattgaaaatacgggacaa
tatcgtggcgtttatcatgttttgggcggaaagatttctcccatggaaggcataggtccc
gaaaaattaaacatcgttcccctactcgaacgcgccaaaaatgccaaagaaatcattttt
gccatgagtagcaccatggagggcgacaccacggttttctatctatataaattactaaaa
gacagcgatgtaaaactttccaccatcgcacgcggaatcggtgtgggcgacgagctcgag
tatgccgacgagctcacgctagggcgttctatcacgcaccgagtgccgtacgaagataat
ttataa

DBGET integrated database retrieval system