KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1482Help
Entry
Ornrh_1482        CDS       T02145                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ornrh_1482
   01230 Biosynthesis of amino acids
    Ornrh_1482
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ornrh_1482
   00051 Fructose and mannose metabolism
    Ornrh_1482
   00562 Inositol phosphate metabolism
    Ornrh_1482
Enzymes [BR:orh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ornrh_1482
Exosome [BR:orh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ornrh_1482
  Exosomal proteins of bladder cancer cells
   Ornrh_1482
  Exosomal proteins of melanoma cells
   Ornrh_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1515870..1516637
Genome map
AA seq 255 aa AA seqDB search
MRKKIVAGNWKMNKNWAEAKELLLGVNSFVSSRNPKCEVIVAPPATYLLNAAEIFQSNAE
ISAQNVSEFEPGAYTGEISTDILNSIGVKYSIIGHSERRSIFGETNEQIGKKVDKALAAN
ISPILCCGEVLEERKANKHVDVVSEQLKAALKNVKKEQMKDVIIAYEPVWAIGTGETATP
EQAQEMHAEIRALLRSLFDQETSEAVRILYGGSVKPSNADELFSQPDIDGGLVGGASLNI
EDFSALITSGSNATK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaatcgtagcaggaaactggaaaatgaataaaaactgggcagaggctaaa
gagcttttgcttggtgtaaatagctttgtttcgtcaagaaacccaaaatgtgaagtgatc
gtagcaccccctgctacttatttgctaaacgcagcggagattttccaaagcaatgcggag
atttctgctcaaaatgtttctgaatttgaaccaggagcttacacaggagagatttctacc
gatattttaaattcaattggagtaaaatattcaatcattgggcactcagagcgtcgttca
atctttggagagaccaacgagcaaatcggaaaaaaagtagacaaagctttggctgctaat
atttcgccaattctttgttgtggagaggtgcttgaagaaagaaaagctaacaagcatgta
gatgtagtgtctgaacaattgaaagctgcacttaaaaatgtgaaaaaagagcaaatgaaa
gatgtaatcattgcttatgagccagtttgggcaattggaacaggtgaaactgctacgcca
gagcaagctcaggaaatgcacgctgaaatcagagctttattaagaagtttatttgatcaa
gaaacatcagaggctgtaagaatcctttacggaggaagtgtaaaacctagcaatgcagac
gaattattctctcagccagacatcgatggtggacttgtgggaggagcttcattaaacatc
gaagatttctctgccttaatcacttcaggtagcaacgctacaaaataa

DBGET integrated database retrieval system