KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1511Help
Entry
Ornrh_1511        CDS       T02145                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00260  Glycine, serine and threonine metabolism
orh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01130  Biosynthesis of antibiotics
orh01230  Biosynthesis of amino acids
Module
orh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ornrh_1511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1511
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ornrh_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP THUMP
Motif
Other DBs
NCBI-ProteinID: AFL97677
UniProt: I4A143
Position
1544051..1545238
Genome map
AA seq 395 aa AA seqDB search
MNYRNPDKNGYYGEFGGAFVPEMLYPNVQELQENYLKIIESESFKNEFNDLLKNYVGRET
PLYFSKKLSEKYGAQIYLKREDLNHTGAHKINNALGQALLAKKLGKHRIIAETGAGQHGV
ATATACALLDMECIVYMGAVDIERQAPNVARMEMLGAKVVPATSGSKTLKDAVNEALRDW
INNPTTTHYIIGSAVGPHPFPDMVARFQSVISEEIKKQLNEKIGRENPDYVIACVGGGSN
AAGTFYHFVNEESVKIIGAEASGLGVDSGETAATTALGTVGVLHGFQSLVMQTKDGQVIE
PYSISAGLDYPGIGPMHANLFTQKRAEFIPVSDDEALKAAYELTREEGIIPALESSHALA
ILPKKNFKKDDVVVICLSGRGDKDMATYLKKMNEF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaattatagaaatccagataaaaacggctattatggagaatttggaggtgcatttgtc
cctgaaatgctctaccccaatgtgcaagaattgcaagaaaattatttgaaaatcatagag
agcgaatcgtttaaaaacgaatttaatgatttgcttaaaaactatgtggggcgcgagacg
ccactgtatttttctaaaaaattaagcgaaaaatatggagcacaaatttatctcaagcgc
gaagatttaaaccacacgggggcgcataaaatcaataatgcgctggggcaagcactttta
gccaaaaaattgggaaaacatagaattattgccgaaacgggcgcaggacaacacggcgtg
gctacggctacggcttgtgctttgctcgatatggaatgcattgtttacatgggcgcagtc
gatattgaaagacaagcacccaatgtggctcgtatggaaatgctcggtgcgaaggtagtg
cctgcaacttcgggctctaaaacgctaaaagacgctgtaaatgaggcgttgagagattgg
atcaataatccaacaactacacactacatcattgggagtgccgtggggcctcaccctttc
cctgatatggtggcgagatttcaaagtgtgatttcggaggaaatcaaaaagcaattaaac
gaaaaaatcggacgagaaaatcctgattatgtgattgcttgcgtgggaggtggaagtaat
gccgcaggaacattttaccattttgtaaacgaagaatcggtgaaaattatcggagcagaa
gcgagcggacttggtgttgattctggcgaaacggcagcgactacggctttaggtacggtg
ggagttttgcacgggttccagagtttggttatgcaaactaaagatggacaagtgattgag
ccttattctatttcggcaggattagattatccaggaattggacctatgcacgctaattta
tttacgcaaaaacgagcagaatttattcctgtatcagatgatgaagcattgaaagcagct
tatgaattaacgagagaagaaggaataatcccagcactcgaaagctcgcatgcacttgcg
attttacctaagaaaaactttaaaaaagacgatgttgtggtaatttgtttaagcggaaga
ggagacaaagacatggcgacttatttgaaaaaaatgaacgaattttaa

DBGET integrated database retrieval system