KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1511Help
Entry
Ornrh_1511        CDS       T02145                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ornrh_1511
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ornrh_1511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1511
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ornrh_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544051..1545238
Genome map
AA seq 395 aa AA seqDB search
MNYRNPDKNGYYGEFGGAFVPEMLYPNVQELQENYLKIIESESFKNEFNDLLKNYVGRET
PLYFSKKLSEKYGAQIYLKREDLNHTGAHKINNALGQALLAKKLGKHRIIAETGAGQHGV
ATATACALLDMECIVYMGAVDIERQAPNVARMEMLGAKVVPATSGSKTLKDAVNEALRDW
INNPTTTHYIIGSAVGPHPFPDMVARFQSVISEEIKKQLNEKIGRENPDYVIACVGGGSN
AAGTFYHFVNEESVKIIGAEASGLGVDSGETAATTALGTVGVLHGFQSLVMQTKDGQVIE
PYSISAGLDYPGIGPMHANLFTQKRAEFIPVSDDEALKAAYELTREEGIIPALESSHALA
ILPKKNFKKDDVVVICLSGRGDKDMATYLKKMNEF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaattatagaaatccagataaaaacggctattatggagaatttggaggtgcatttgtc
cctgaaatgctctaccccaatgtgcaagaattgcaagaaaattatttgaaaatcatagag
agcgaatcgtttaaaaacgaatttaatgatttgcttaaaaactatgtggggcgcgagacg
ccactgtatttttctaaaaaattaagcgaaaaatatggagcacaaatttatctcaagcgc
gaagatttaaaccacacgggggcgcataaaatcaataatgcgctggggcaagcactttta
gccaaaaaattgggaaaacatagaattattgccgaaacgggcgcaggacaacacggcgtg
gctacggctacggcttgtgctttgctcgatatggaatgcattgtttacatgggcgcagtc
gatattgaaagacaagcacccaatgtggctcgtatggaaatgctcggtgcgaaggtagtg
cctgcaacttcgggctctaaaacgctaaaagacgctgtaaatgaggcgttgagagattgg
atcaataatccaacaactacacactacatcattgggagtgccgtggggcctcaccctttc
cctgatatggtggcgagatttcaaagtgtgatttcggaggaaatcaaaaagcaattaaac
gaaaaaatcggacgagaaaatcctgattatgtgattgcttgcgtgggaggtggaagtaat
gccgcaggaacattttaccattttgtaaacgaagaatcggtgaaaattatcggagcagaa
gcgagcggacttggtgttgattctggcgaaacggcagcgactacggctttaggtacggtg
ggagttttgcacgggttccagagtttggttatgcaaactaaagatggacaagtgattgag
ccttattctatttcggcaggattagattatccaggaattggacctatgcacgctaattta
tttacgcaaaaacgagcagaatttattcctgtatcagatgatgaagcattgaaagcagct
tatgaattaacgagagaagaaggaataatcccagcactcgaaagctcgcatgcacttgcg
attttacctaagaaaaactttaaaaaagacgatgttgtggtaatttgtttaagcggaaga
ggagacaaagacatggcgacttatttgaaaaaaatgaacgaattttaa

DBGET integrated database retrieval system