KEGG   Ornithobacterium rhinotracheale: Ornrh_1512Help
Entry
Ornrh_1512        CDS       T02145                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ornrh_1512
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ornrh_1512
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1512
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ornrh_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545249..1545983
Genome map
AA seq 244 aa AA seqDB search
MKKLNIYFTAGMPALEDTAEIARVAQEAGADMLEIGIPYSDPVADGPVIQDAHMKALANG
MTIEKLFEQLATIKETVTIPKILMGYLNPVLQFGFENFCKKCAENGISGLILPDLPPVEF
EKKYGAILQKYNLNFTFLVTPETSDERIKYLDSLSSGFVYAVSSSSTTGNAEKQINNEAY
LDRLQKLNLNNPVMIGFGIKNKADFEKVTQKADGGIIGTAFVKILLENKDWKDKAKSFIQ
SVKN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatatatatttcacagcaggaatgccagctttggaagacacggcagaa
attgcgcgtgtggcacaagaggcgggtgctgatatgcttgaaattggaattccgtattct
gatcccgtggcagatggtcctgtgattcaagatgcgcacatgaaagcccttgccaacgga
atgacgattgaaaaattgtttgagcaattggctacgattaaagaaacagtaacgattccc
aaaattctgatgggatacttgaatcccgttttgcaatttgggtttgagaatttttgtaaa
aaatgtgccgaaaatggaatttctggtttgattttgcctgatttgccacccgtggaattt
gagaaaaaatacggtgcaatccttcaaaaatataatttaaatttcacttttttggtaacg
cccgaaacttcagacgagcgtatcaaatatttagacagtttaagctctggttttgtgtat
gctgtgagctcatcgtccaccacgggcaatgccgaaaagcagattaataacgaggcttat
ttggatagattgcaaaaattaaatcttaataatcccgtgatgataggttttgggattaag
aataaagctgattttgaaaaagtaacccagaaagccgatggtggaatcatcgggacagct
tttgtaaagattttgcttgaaaacaaagattggaaagataaggctaaaagctttattcag
tcggtgaagaattaa

DBGET integrated database retrieval system