KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1512Help
Entry
Ornrh_1512        CDS       T02145                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00260  Glycine, serine and threonine metabolism
orh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01130  Biosynthesis of antibiotics
orh01230  Biosynthesis of amino acids
Module
orh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ornrh_1512
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1512
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ornrh_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: AFL97678
UniProt: I4A144
Position
1545249..1545983
Genome map
AA seq 244 aa AA seqDB search
MKKLNIYFTAGMPALEDTAEIARVAQEAGADMLEIGIPYSDPVADGPVIQDAHMKALANG
MTIEKLFEQLATIKETVTIPKILMGYLNPVLQFGFENFCKKCAENGISGLILPDLPPVEF
EKKYGAILQKYNLNFTFLVTPETSDERIKYLDSLSSGFVYAVSSSSTTGNAEKQINNEAY
LDRLQKLNLNNPVMIGFGIKNKADFEKVTQKADGGIIGTAFVKILLENKDWKDKAKSFIQ
SVKN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatatatatttcacagcaggaatgccagctttggaagacacggcagaa
attgcgcgtgtggcacaagaggcgggtgctgatatgcttgaaattggaattccgtattct
gatcccgtggcagatggtcctgtgattcaagatgcgcacatgaaagcccttgccaacgga
atgacgattgaaaaattgtttgagcaattggctacgattaaagaaacagtaacgattccc
aaaattctgatgggatacttgaatcccgttttgcaatttgggtttgagaatttttgtaaa
aaatgtgccgaaaatggaatttctggtttgattttgcctgatttgccacccgtggaattt
gagaaaaaatacggtgcaatccttcaaaaatataatttaaatttcacttttttggtaacg
cccgaaacttcagacgagcgtatcaaatatttagacagtttaagctctggttttgtgtat
gctgtgagctcatcgtccaccacgggcaatgccgaaaagcagattaataacgaggcttat
ttggatagattgcaaaaattaaatcttaataatcccgtgatgataggttttgggattaag
aataaagctgattttgaaaaagtaacccagaaagccgatggtggaatcatcgggacagct
tttgtaaagattttgcttgaaaacaaagattggaaagataaggctaaaagctttattcag
tcggtgaagaattaa

DBGET integrated database retrieval system