KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1512Help
Entry
Ornrh_1512        CDS       T02145                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ornrh_1512
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ornrh_1512
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1512
Enzymes [BR:orh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ornrh_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1545249..1545983
Genome map
AA seq 244 aa AA seqDB search
MKKLNIYFTAGMPALEDTAEIARVAQEAGADMLEIGIPYSDPVADGPVIQDAHMKALANG
MTIEKLFEQLATIKETVTIPKILMGYLNPVLQFGFENFCKKCAENGISGLILPDLPPVEF
EKKYGAILQKYNLNFTFLVTPETSDERIKYLDSLSSGFVYAVSSSSTTGNAEKQINNEAY
LDRLQKLNLNNPVMIGFGIKNKADFEKVTQKADGGIIGTAFVKILLENKDWKDKAKSFIQ
SVKN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaaatatatatttcacagcaggaatgccagctttggaagacacggcagaa
attgcgcgtgtggcacaagaggcgggtgctgatatgcttgaaattggaattccgtattct
gatcccgtggcagatggtcctgtgattcaagatgcgcacatgaaagcccttgccaacgga
atgacgattgaaaaattgtttgagcaattggctacgattaaagaaacagtaacgattccc
aaaattctgatgggatacttgaatcccgttttgcaatttgggtttgagaatttttgtaaa
aaatgtgccgaaaatggaatttctggtttgattttgcctgatttgccacccgtggaattt
gagaaaaaatacggtgcaatccttcaaaaatataatttaaatttcacttttttggtaacg
cccgaaacttcagacgagcgtatcaaatatttagacagtttaagctctggttttgtgtat
gctgtgagctcatcgtccaccacgggcaatgccgaaaagcagattaataacgaggcttat
ttggatagattgcaaaaattaaatcttaataatcccgtgatgataggttttgggattaag
aataaagctgattttgaaaaagtaacccagaaagccgatggtggaatcatcgggacagct
tttgtaaagattttgcttgaaaacaaagattggaaagataaggctaaaagctttattcag
tcggtgaagaattaa

DBGET integrated database retrieval system