KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1764Help
Entry
Ornrh_1764        CDS       T02145                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00230  Purine metabolism
orh01100  Metabolic pathways
Module
orh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ornrh_1764
Enzymes [BR:orh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ornrh_1764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 cobW AAA_22 TsaE MobB ABC_tran RsgA_GTPase Thymidylate_kin AAA DUF1827 ThiF Viral_helicase1 MMR_HSR1 AAA_30 AAA_19 AAA_25
Motif
Other DBs
NCBI-ProteinID: AFL97917
UniProt: I4A1T3
Position
complement(1766451..1767020)
Genome map
AA seq 189 aa AA seqDB search
MNSGKLIIFSAPSGAGKTTLVKHLLKTRNDLAFSISCATRAPRKGEVDGVDYYFLTPEEF
KQKVANNEFVEWEEVYENHCYGTLKSEIERIWNAGKNVVFDIDVMGGINLKKQFGDKALS
IFVQPPSVETLAQRLRDRNTDSPEKLEMRIAKATKELEFAKDFDIILVNDDLEVAKKEVN
EIVENFISK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcggaaaactcatcatattttcagcgccttctggagcaggcaaaaccactttg
gtaaaacacctacttaaaacaagaaacgatttggctttctctatttcgtgtgctacgcgt
gctccacgcaagggcgaagtagacggcgtggattattattttttgacacccgaagagttt
aaacaaaaagtggcaaataatgaatttgtagaatgggaagaggtctacgaaaaccactgc
tacggcaccttaaaatcagaaattgaacgcatttggaacgcaggaaaaaatgtagttttt
gacattgatgtaatgggcggcatcaatcttaaaaaacaatttggagacaaagctctttct
attttcgtgcagccaccaagcgtggaaactttggctcaacgactacgcgaccgcaatacc
gattcgccagaaaaattggaaatgcgtattgccaaagctaccaaagaactagaatttgcc
aaggattttgacatcattttggtaaacgatgacttggaagttgccaaaaaagaagtgaac
gaaattgtagaaaattttatttctaaataa

DBGET integrated database retrieval system