KEGG   Ornithobacterium rhinotracheale: Ornrh_1875Help
Entry
Ornrh_1875        CDS       T02145                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ornrh_1875
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ornrh_1875
  Amino acid metabolism
   00310 Lysine degradation
    Ornrh_1875
Enzymes [BR:orh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ornrh_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1887408..1888739)
Genome map
AA seq 443 aa AA seqDB search
MAEYKFLLPSMGEGIMEATVTAWLKNVGDSIEEDESIVEVATDKVDSDVPSPVSGVLKEI
IIPTDSVAKVGEPMAIITTDGDEEEPAAYTPKSEAPTPEPSPEIAQAAKEAEKALNVVKT
PASIDLGESDKFLSPLVRSIAAKEGISAEELNSIQGSGQNGRVTKDDMLRYLEQKDQQPN
TSSAPAPAASAPQTQTPSPAPKAISLGANDEIIEMDRMRKIIAQHMLDSKQISPHVTSFV
EADMTRIVQWRNRVKNAFQKREGEKITFMPIIVEAIVKAIKDFPMINVSVDGDKIIKKAN
INIGIAAARPDGNLIVPVIKNADQLNLIGLAKKINDLGYRAKNNQLKPDEIQGGTYTVSN
IGSFGNLMGTPIINQPQVAIMAIGSIQKKPAVIETPEGDTIGIRHKMYLSHSYDHRVVDG
ALGGMFVKRVAEYLESFDIDRGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatataaatttttacttccatccatgggagaaggcatcatggaagccaccgtt
acagcatggctaaagaatgtaggcgatagcatcgaagaagatgagtcgattgtagaagta
gccaccgacaaagtggattctgatgttccttcgcctgtaagtggtgttttaaaagaaatc
attatccctacagatagcgttgctaaagtgggcgagccaatggctatcatcactaccgat
ggcgacgaagaggaaccagccgcttatacgcccaaatctgaggcaccgacaccagaacct
agccctgaaatagctcaagccgcaaaagaggctgaaaaggctttaaatgtagtaaaaacg
cctgctagcattgatttgggcgaaagcgataaattcttatctccacttgtgcgttctatc
gctgccaaagaaggaatttctgccgaagagttaaacagcattcaaggttctgggcaaaat
ggtagagtgaccaaagatgatatgcttcgttatttggaacaaaaagaccagcaaccaaac
acttcctctgctcctgccccagcagcttcagcaccgcaaacgcaaactcctagccctgcc
cctaaagccataagcctaggtgcaaacgatgaaatcatcgaaatggatcgcatgcgaaaa
atcatcgctcaacacatgctagacagcaagcaaatttctccgcatgttacctcctttgta
gaggcagatatgacgcgcatcgttcaatggagaaatcgtgtgaaaaatgcgttccaaaaa
cgcgagggagaaaaaatcacctttatgccaatcatcgtagaggcaattgtgaaagctatt
aaagattttccgatgattaatgtttctgtagatggcgacaaaatcatcaaaaaagcaaat
atcaatatcggtatagctgctgcaagaccagacggaaacttgattgttcctgtgattaaa
aatgctgatcaattgaatttaattggtttggctaaaaaaatcaatgatttgggataccga
gctaaaaataatcagcttaaaccagacgaaatccaaggaggaacttacaccgtttcaaac
attggtagctttggtaatttaatgggcactccaatcatcaatcagccacaagtggcgatt
atggcaatcggaagtatccaaaagaaacctgccgtgattgaaacgccagaaggcgatacc
ataggcattcgccacaaaatgtatctctcccactcctacgaccaccgcgtggtagacgga
gctctgggcggtatgtttgtgaaacgagtggcagaatatcttgaatcgtttgacatcgac
cgaggtatttaa

DBGET integrated database retrieval system