KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1875Help
Entry
Ornrh_1875        CDS       T02145                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ornrh_1875
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ornrh_1875
  Amino acid metabolism
   00310 Lysine degradation
    Ornrh_1875
Enzymes [BR:orh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ornrh_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1887408..1888739)
Genome map
AA seq 443 aa AA seqDB search
MAEYKFLLPSMGEGIMEATVTAWLKNVGDSIEEDESIVEVATDKVDSDVPSPVSGVLKEI
IIPTDSVAKVGEPMAIITTDGDEEEPAAYTPKSEAPTPEPSPEIAQAAKEAEKALNVVKT
PASIDLGESDKFLSPLVRSIAAKEGISAEELNSIQGSGQNGRVTKDDMLRYLEQKDQQPN
TSSAPAPAASAPQTQTPSPAPKAISLGANDEIIEMDRMRKIIAQHMLDSKQISPHVTSFV
EADMTRIVQWRNRVKNAFQKREGEKITFMPIIVEAIVKAIKDFPMINVSVDGDKIIKKAN
INIGIAAARPDGNLIVPVIKNADQLNLIGLAKKINDLGYRAKNNQLKPDEIQGGTYTVSN
IGSFGNLMGTPIINQPQVAIMAIGSIQKKPAVIETPEGDTIGIRHKMYLSHSYDHRVVDG
ALGGMFVKRVAEYLESFDIDRGI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatataaatttttacttccatccatgggagaaggcatcatggaagccaccgtt
acagcatggctaaagaatgtaggcgatagcatcgaagaagatgagtcgattgtagaagta
gccaccgacaaagtggattctgatgttccttcgcctgtaagtggtgttttaaaagaaatc
attatccctacagatagcgttgctaaagtgggcgagccaatggctatcatcactaccgat
ggcgacgaagaggaaccagccgcttatacgcccaaatctgaggcaccgacaccagaacct
agccctgaaatagctcaagccgcaaaagaggctgaaaaggctttaaatgtagtaaaaacg
cctgctagcattgatttgggcgaaagcgataaattcttatctccacttgtgcgttctatc
gctgccaaagaaggaatttctgccgaagagttaaacagcattcaaggttctgggcaaaat
ggtagagtgaccaaagatgatatgcttcgttatttggaacaaaaagaccagcaaccaaac
acttcctctgctcctgccccagcagcttcagcaccgcaaacgcaaactcctagccctgcc
cctaaagccataagcctaggtgcaaacgatgaaatcatcgaaatggatcgcatgcgaaaa
atcatcgctcaacacatgctagacagcaagcaaatttctccgcatgttacctcctttgta
gaggcagatatgacgcgcatcgttcaatggagaaatcgtgtgaaaaatgcgttccaaaaa
cgcgagggagaaaaaatcacctttatgccaatcatcgtagaggcaattgtgaaagctatt
aaagattttccgatgattaatgtttctgtagatggcgacaaaatcatcaaaaaagcaaat
atcaatatcggtatagctgctgcaagaccagacggaaacttgattgttcctgtgattaaa
aatgctgatcaattgaatttaattggtttggctaaaaaaatcaatgatttgggataccga
gctaaaaataatcagcttaaaccagacgaaatccaaggaggaacttacaccgtttcaaac
attggtagctttggtaatttaatgggcactccaatcatcaatcagccacaagtggcgatt
atggcaatcggaagtatccaaaagaaacctgccgtgattgaaacgccagaaggcgatacc
ataggcattcgccacaaaatgtatctctcccactcctacgaccaccgcgtggtagacgga
gctctgggcggtatgtttgtgaaacgagtggcagaatatcttgaatcgtttgacatcgac
cgaggtatttaa

DBGET integrated database retrieval system