KEGG   Ornithobacterium rhinotracheale: Ornrh_1885Help
Entry
Ornrh_1885        CDS       T02145                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:orh00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1899094..1899876
Genome map
AA seq 260 aa AA seqDB search
MNELLQKAIQAALQAGQEILKIYEQDFAVEHKADESPLTQADLASNRVIVDFLKNTQIPI
ISEEMQQEKYALRKDWARFWLVDPLDGTKEFVNRNGEFTVNIALIENGTPVLGVIYAPCL
KWLYFADETGSFKQEKITQYSEFSKDLAQKLYYQKPQENVVVVASRSHLNEPTEKFIQKL
NLKYQSVERISMGSSLKLCLVAESKAHVYPRFAPTMEWDIAAGHAICRFAGVSVVQAETG
EPIAYNKENLLNPYFLVGEV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcttttgcaaaaagcaatacaagcagccttgcaagcagggcaggagatttta
aagatttatgagcaagattttgcagtagagcataaggcagatgagtctccactcacgcag
gcagatttggcgtccaatcgtgtgattgtagattttctgaaaaacacccaaattccgatc
attagcgaagaaatgcagcaggagaaatacgctttgcgcaaagattgggctcgcttttgg
ctcgtagacccgttggacggcaccaaggagtttgtaaatagaaacggagagttcaccgta
aatatagccttaatcgaaaatggaacacccgttttgggcgtaatttatgcaccatgctta
aaatggctttattttgctgatgaaacgggaagctttaaacaagaaaaaattacccaatat
tcggaattttcaaaggatttagcccaaaagttatattaccaaaagccgcaggagaatgtc
gtggtagtggcaagtcgctcgcatctcaacgagccgacggaaaaattcattcaaaaatta
aatttaaaatatcaatccgtagagagaatttctatgggcagttcgcttaaattatgtttg
gtcgcggaatccaaagcacatgtgtatccccgatttgcccccacaatggagtgggacata
gctgcggggcatgccatttgccgatttgcaggcgtttccgtagttcaggctgaaacgggc
gagccaattgcgtataacaaagaaaatctattaaatccctattttttggtaggagaagta
tag

DBGET integrated database retrieval system