KEGG   Ornithobacterium rhinotracheale: Ornrh_1985Help
Entry
Ornrh_1985        CDS       T02145                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
orh  Ornithobacterium rhinotracheale
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ornrh_1985
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Ornrh_1985
Enzymes [BR:orh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Ornrh_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2017169..2019517
Genome map
AA seq 782 aa AA seqDB search
MKTIQLFCLGFFGLILSCTAVQNNAEPKKTAFSTIQKDQIIPVPQKVEYEMGAFVFSPET
KIYISNENQRYVAELIQAKFQPAMGYELPIVTQKPKTNFIGFEEDTHLKPENYTLKVNPN
FIELKASDRAGFVYAYESLRQLLPPEIESGNLIKKQWAVQAQNITDFPEFKWRGVMLDVS
RHFFSKDYILSTIDRLALLKMNTLHLHLIDDQGWRIEIKKYPKLTEVGAWRADHEDKHWD
ARPPQKPGEKATYGGFYTQEELKEIVAYATERGINVVPEIEMPAHVTSAIAAYPEYSCQG
KPVTVPTGGLWPITDIYCAGQEKTFKFLEDVLDEVMEIFPSEYIHIGGDEATKTNWKTCP
HCQERMREEGLKDEKELQSYFIKRIEKYLNQHGRKLVGWDEILEGGIAPEATVMSWRGFD
GGIEAANQGHDVVMTPGDYAYFDAYQGTPQNEPLAIGGYKTLSKVYEFNPIPPQIAPDKK
HHILGAQANLWAEFVPNEKHSEYMLYPRLFAMSEVLWSSPKQRDIKDFFSRVYVMMDRFD
RLGINYAKSIYEVTGKEKIDEKDPNVIWLTLSNEIPTAMDIRYTIDDKNLAKNAKKYTSP
IKITKNCTVRASLFKDGKPINNVYEKTFKFHKAVGATVSYEPMYHKSYQGQHETNMVNLL
RGTEDFHDGQWQAWLRDNATITLDLHQPIDMSEVVVGMMQKQSSGIYFPLEVVAYVSLDG
KSFKKVGEIKQPYEENGLAELKNYAFAFKHQKAQFVKIFIKNIAHPPKGGDAWIFVDEVM
VN
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatacaattattttgtcttggtttttttggcttaatcttgtcgtgcaccgcg
gtgcagaataatgctgagccaaaaaaaacagcatttagcacaattcaaaaagatcaaatc
atacccgttccgcaaaaggtggaatatgaaatgggagcttttgtattttcgcctgaaacc
aaaatttacatttccaacgaaaatcagcgttatgtagcggaattaattcaggctaaattc
cagccagcaatgggctacgaattgcccatcgttacccaaaagcctaaaacgaattttata
ggttttgaagaagatactcatttaaaaccagaaaattatactttaaaagtaaatccaaat
tttatagaattaaaggcaagcgaccgagcaggctttgtgtatgcctatgagtctttgcgc
caattgcttccgccagaaattgagtcgggaaatttaatcaagaaacaatgggcggtgcaa
gcgcaaaacattacagatttcccagagtttaaatggcgtggcgtgatgctcgatgtgtca
agacattttttctccaaagattatattttaagcacaatcgatcgtttggctttgttgaaa
atgaatacacttcatttgcatttaatagatgatcaaggttggcgaattgagattaagaaa
tatccaaaacttaccgaagtaggcgcgtggcgtgcagaccacgaagataaacattgggac
gctcgccctccgcaaaaacctggcgaaaaagctacttatggtggtttttatacccaagaa
gagctgaaggaaatcgtggcttatgccaccgagcgtggcatcaatgtagtgccagaaatc
gagatgccagcccatgttacgagtgcaattgcagcttatcccgaatactcttgccaaggc
aaacccgttacggtaccaacaggtgggctatggccaattactgatatttactgtgcagga
caggaaaaaacttttaaatttttggaagatgttttggatgaagtgatggagattttccct
tcggagtacattcatatcgggggagatgaagctaccaaaaccaactggaaaacttgtccg
cactgccaagaaagaatgagagaagaaggcttaaaagatgaaaaagaattgcaaagttat
ttcattaagcgtatcgaaaaatatttgaaccagcatggcagaaagttagttggttgggac
gagatcttggagggcggcattgctcccgaagctacggtgatgagctggcgtggctttgat
ggcggaatcgaagcggcaaatcaaggacacgatgttgtgatgacgccaggagactatgcc
tattttgatgcctatcaaggaacgccacaaaacgagcctttggcaattggaggatacaaa
acgcttagcaaagtttatgagtttaatcctattccaccacagattgcacccgacaaaaaa
catcatattctaggagcacaagccaatttatgggcggagtttgtgccaaacgaaaagcac
tcggagtacatgttgtatccgcgtctttttgccatgtcagaagtgttgtggtcttcgcct
aagcagcgcgacatcaaggatttcttctctcgtgtgtatgtgatgatggatcgtttcgac
cgattgggcatcaactatgcaaagagcatttacgaagttacgggaaaagaaaaaatagat
gaaaaagatccaaatgtaatttggctgactttgtccaacgaaattccaactgctatggac
attcgttataccattgatgataaaaatttagccaaaaatgctaaaaaatacacttctcct
atcaagattacgaaaaactgcaccgtgcgtgcctctttgtttaaagacggaaagcctatc
aataatgtgtatgagaaaacatttaaattccataaagcagtgggcgcaacggtaagttac
gagccaatgtatcacaaaagctatcaaggtcagcacgagaccaatatggtgaatttgctc
cgtggtaccgaggatttccacgatgggcaatggcaggcatggttgagagataatgccact
attacacttgatttgcatcaacctatcgacatgagcgaagtggtagtgggcatgatgcaa
aaacaaagttcgggtatttatttcccgctagaagtggtggcttatgtttcgcttgatggc
aagagttttaaaaaagtgggcgaaattaaacagccttatgaggaaaatggattggctgag
ttaaagaattatgcctttgcatttaagcatcaaaaagcacaatttgtgaaaatctttatc
aaaaacattgcacatccacctaagggcggcgacgcatggatttttgtagatgaagtcatg
gtaaactag

DBGET integrated database retrieval system