KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324282Help
Entry
4324282           CDS       T01015                                 

Definition
(RefSeq) Os01g0232700
  KO
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4324282
  Amino acid metabolism
   00340 Histidine metabolism
    4324282
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     4324282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 473 aa AA seqDB search
MSLRPGRAHPLAASPLHTPLPARPRPQLRLSTSTSCAAMKSYRLSELSDAEVGGLKARPR
IDFSSIFGTVNPIVEDVRMRGDAAVKDYTVKFDKVALDDVVVRVSDLPDVELDPAVKEAF
DVAYDNIYAFHVSQKLPEKTVENMKGVRCKRITRCIGSVGLYVPGGTAVLPSTALMLAVP
AQIAGCKTVVLATPPSRDGSICKEVLYCAKKAGVTHVLKAGGAQAISAMAWGTVSCPKVE
KIFGPGNQYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADKYANPVHVAADLLSQAEHGP
DSQVVLVVAGDGVDLGAIEAEVSKQCSALPRGEFASKALGHSFTVFAKDMVEAISFSNMY
APEHLIINVKDAEQWEDLVENAGSVFLGQWTPESVGDYASGTNHVLPTYGYARMYSGVSL
NSFLKYITVQSLSEEGLRSLGPHVAKMAEVEGLEAHRRAVTLRLQDIEATVTV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgcggccgggcagggcgcaccccctcgccgcgtctcccctccacaccccgctc
cctgctaggcctaggccccagctgaggctgagcacctccaccagctgcgccgccatgaag
tcgtacaggctgtcggagctcagcgacgccgaggtcggcggcctcaaggcgcgcccccgc
atcgacttctcctccattttcggcacggtcaatccgattgttgaagacgtgcgcatgcga
ggcgatgctgcggtcaaggattatacagtgaagttcgacaaggttgcactcgatgatgtg
gttgtgcgtgttagcgatcttccggatgtggagcttgatccagctgtgaaggaagccttt
gatgtggcatatgacaacatttatgccttccacgtttcgcaaaagttgcctgaaaagact
gttgagaatatgaaaggtgtaagatgtaaaagaataacaagatgcattggttctgttggc
ctttatgtcccaggtggcactgcagtattgccttccactgcattgatgcttgctgtgcct
gcacagattgctggttgcaaaactgttgttcttgccacaccccctagtcgtgatggtagc
atatgtaaggaggttctttactgtgctaaaaaagctggtgtgacacatgtattgaaagct
ggaggagctcaggccatttcagccatggcatggggaacagtctcatgcccaaaggttgaa
aaaatatttggacctggaaatcagtatgtcacggctgcaaaaatgattcttcagaacagt
gaagccatggtttctatagacatgcctgctggcccttcagaagtattagtgatagcggat
aaatatgcaaacccagttcatgttgctgctgatttgttatctcaggcggaacatggccca
gacagtcaggttgttctagttgttgcgggagacggtgttgatttgggtgctattgaggca
gaagttagcaagcagtgctctgctcttcctaggggagaatttgcttcgaaagctcttggc
cacagtttcactgtttttgcgaaagacatggttgaggcaatttcattctccaatatgtat
gcccctgagcatttgatcatcaatgtaaaggatgctgaacagtgggaggatcttgtcgag
aatgcagggtcggtcttcttgggacaatggaccccggagagcgtgggcgactatgcaagc
ggcacaaaccatgtccttccaacctatggttacgcaaggatgtatagcggcgtgtcactg
aactcattcctcaagtacatcactgtccagtccttgtcagaggaagggttgagaagtctg
ggtccgcatgtggcaaagatggctgaagtcgaaggactagaggctcacagaagagctgtt
accctcagacttcaggacatcgaagccactgtaaccgtgtag

DBGET integrated database retrieval system