KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324478Help
Entry
4324478           CDS       T01015                                 

Definition
(RefSeq) sec-independent protein translocase protein TATC, chloroplastic
  KO
K03118  
sec-independent protein translocase protein TatC
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein export
Module
Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    4324478
Secretion system [BR:osa02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   4324478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 359 aa AA seqDB search
MGSAGALLSHSPPGLGGFPPRHHHHHRLSVLRCVPLLPSPAPEPLSCRHGRHLRCAAVDG
GAGRETERPSPPAPQREESPSGSLGAALEDPSPQPVQNGSFGGITEDEEQSSLYNFLYPS
KELLPDDKEMSIFDHLEELRDRIFVSVLAVGAAILGCFAYSKDLIRILEAPVSVQGVRFL
QLSPGEFFFTTLKVSGYCGLLLGSPVILYEIIAFVLPGLTRDERKFLGPIVLGSSVLFYL
GIFFSYTVLAPAALNFFVNYADGAVESLWSIDQYFEFVLVLLFSTGLSFQVPVIQLLLGQ
VGLVSSDQMLSIWRYVVVGAVVAAAVLTPSTDPLTQMLLAGPLLGLYLGGAWMVKLTGR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgcgggggcgctgctctcgcactcgcctccggggctcggcggattccctcct
cgccaccatcaccaccaccgtctctccgtcctccgttgcgtaccgctcctcccctccccg
gcgcccgagcccctcagctgtcgccacggccggcaccttcgctgcgccgccgtcgacggg
ggagccggccgggagacggagcgtccctcgccgcccgcacctcagagggaggagtcgccg
tcgggcagcctcggcgcagccctcgaggacccatctcctcaacctgtccaaaatggatct
tttggaggtatcacagaggatgaagaacagagtagcctgtacaattttctttatccgagc
aaagagctacttcctgatgataaggagatgagtatatttgatcatctagaggaacttcgt
gacaggatatttgtctcagtattggctgttggtgctgcgatacttggttgtttcgcttac
tccaaagatcttattagaattctagaagcaccagttagtgttcagggtgttcggtttctg
cagctctctcctggagaatttttctttacaacattgaaggtctctggttattgtggcctt
ctacttgggagtcctgttattctgtatgagataatagcatttgttcttccgggtttaaca
agggatgaacgtaaattcctagggcccattgttctgggctcttctgtactattctacctt
ggcattttcttctcctacacggttcttgctcctgcagcattgaatttcttcgtgaactac
gcagatggggcagtggaatcgttatggtcgattgatcagtattttgagtttgtgcttgtg
cttttattcagcacaggattatcttttcaggtccctgttatccagctactgctggggcaa
gtcggtttggtttctagtgaccaaatgctttccatctggagatatgttgttgttggcgct
gtagttgctgctgctgtgcttacaccgtcgacagatccgttgactcagatgctcttggct
ggtccgctgcttggcctgtacttgggtggtgcttggatggtcaagctaactggtcgataa

DBGET integrated database retrieval system