KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324500Help
Entry
4324500           CDS       T01015                                 

Definition
Os01g0152900
Orthology
K11252  
histone H2B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4324500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 153 aa AA seqDB search
MAPKAEKKPAAKKPAEEEPAAEKAEKAPAGKKPKAEKRLPAGKGEKGSGEGKKAGRKKGK
KSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAGESAKLARYNKKPTITS
REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaggcggagaagaagccggccgcgaagaagcccgcggaggaggagcccgcg
gcagagaaggccgagaaggcccccgcggggaagaagcccaaggcggagaagcgtctcccc
gccggcaagggcgagaagggcagcggcgaggggaagaaggcggggcggaagaaggggaag
aagagcgtcgagacctacaagatctacatcttcaaggtgctcaagcaggttcaccccgac
atcggcatctcctccaaggccatgtccatcatgaactccttcatcaacgacatcttcgag
aagctcgccggggagtccgccaagctcgcccgctacaacaagaagcccaccatcacctcc
cgggagattcagacctccgtccgcctcgtcctccccggcgagctcgccaagcacgccgtc
tccgagggcacgaaggccgtcaccaagtttacttccgcttag

DBGET integrated database retrieval system