KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324616Help
Entry
4324616           CDS       T01015                                 

Gene name
P0695H10.3
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 13
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4324616 (P0695H10.3)
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4324616 (P0695H10.3)
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    4324616 (P0695H10.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 1110 aa AA seqDB search
MTMVTPRAPELLQQDQDEEMLVPDQDVVVEGPQPMEDSGSTVENEQVPETSTSRFTWTIE
DFSNHRKLYSDVFVVGGHKWRVLVFPTGNSVQSLSMYLDIADANEQPHGWSKYAQFSLAV
INQLDSKYSLRKEAAHHFSTRESDWGFTSFMHLGDLYDPTKGYIVNDKCIIEAEVAVRKI
VDFWNYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDTPCGSIPL
ALQSLFCKLQHSDNSVSTKELTKSFGWDTVDSFLQHDVQELNRVLCEKLENKMKGTTVEG
TIQQLFEGHHMNYIECINVDYKSTRKESFYDLALDVKGCSDVYASFDKYVEVERLEGDNK
YQSEKHGLQDAKKGMLFIDFPPVLQVQLKRFEYDFVRDTMVKINDRYEFPLQLDLDKDDG
KYLSPEADRRVRNLYTLHSVLVHSGGGHGGHYYAFIRPALSDIWYKFDDERVTKEDMKRA
LEEQYGGEEELPHTNPGLNTTPLRFTKHSNAYMLVYIRESDREKIICNLDENDIPEHLKI
RLRKENEEREYKKKEKAEAHMFTALKVARDSDFAEQIGKHIYFDLVDYDNIQSLRAPKHL
TINQAKVDLSKEFGIPVQSQRFWLWAKRQNHTFRPVRPLTLQEEASSIGHLTDPSNKSLN
SELKLFLEVALGQENHPISVPPKTKDDILIFFKLYDPEKEELRYVGKLLVKASGKPADIV
QKLQEMAGFQSDEDIELYEEVMFEPSVMCEPININDSFLSSQLEDGDIICYQKRCSPEKL
DHYRCADVPSFFEYIQNRQVVHFRLLENPKDDDFTLELSKRFTYDDVVEKVANQLGLDDP
SKLRLTQHLPYSQMPKSHYIKYRGLDHLSDMLRNGNQMSDILYYEILDIPLPVLQDLITL
RVAFYHATNNEVSSHFIRLPKGSTMSDLIEDMKSKVELSYSDAEFRLFEVYKNKIRKVYQ
PSEKISVNEFNGLLCVEEVPEEEKNAGVRDRLVHVCHFIIEKQHIDYYGEPFFFLIRDGE
TLSDIKVRIQKKLLVSDEQFAKWKFAYIAHNRLAGEYFQDSDIVLSRFQKDVYGPWEQCL
GLEHSDVTPKRSCLSNQNRNSFDKAVKIFN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggtgaccccgcgcgcacccgagctcctgcagcaggaccaggatgaggagatg
ctggtgccagaccaggatgttgttgttgagggacctcagccgatggaagactctggatca
acagttgagaacgagcaggtaccagaaacctctacgtccagatttacgtggaccattgaa
gatttttcgaatcacagaaagctgtactctgatgtttttgtggttggggggcacaaatgg
cgggtgttagtttttccaactggaaacagtgtacagtccctttcgatgtacctagatatt
gctgacgcaaatgaacagcctcatggatggagtaaatatgcacagttcagccttgctgtg
atcaaccagttagacagcaagtactcactaagaaaagaagcagcacatcatttcagtact
cgggaaagtgattggggcttcacttcttttatgcatttaggagatctatatgatccgact
aaaggttatattgtgaatgataaatgcattattgaggctgaggttgctgtgcgtaaaata
gttgatttctggaattatgattccaaaaaggagactggctatgttggccttaagaatcaa
ggggctacatgctacatgaattctcttcttcagacgctttaccatattccgtacttccga
aaggctgtataccatatgccaactacagagaatgatacaccttgcgggagcatccctttg
gctttgcaaagtcttttctgcaaacttcagcatagtgacaatagtgtttctacaaaagag
cttaccaaatcttttggatgggataccgttgattctttcctgcagcatgatgttcaagaa
ctgaatcgtgttctctgcgaaaaactggaaaacaaaatgaagggaactactgtggaaggg
acaattcaacagctatttgaaggtcatcatatgaattatattgagtgcattaatgttgac
tacaaatctacaaggaaagaatcattctatgatcttgcacttgatgtcaagggctgttca
gatgtttatgcatcatttgataagtatgttgaagtagagagattggaaggtgataataaa
taccagtctgagaaacatggtttgcaggatgccaagaaagggatgctttttattgacttc
cctccagtcctgcaagttcaattaaagcggtttgaatatgattttgtgcgggataccatg
gttaagataaatgaccgctatgagttcccattacaattagatcttgacaaggatgatgga
aaatacctctctccagaagctgacaggagggtgcgtaacctctatactctacacagcgta
cttgttcatagtggtggtggtcatggtggacactactacgcctttatacgcccggcactt
tcagatatatggtacaagtttgatgatgaacgagtgacaaaagaagacatgaagcgggca
ttagaggagcaatacggtggcgaggaagagctcccacataccaatcctggattgaatacc
accccgcttaggtttactaagcattcaaatgcttacatgcttgtgtacattcgtgaaagt
gacagagaaaaaattatttgcaatttagatgaaaacgacataccagaacaccttaagatt
aggttgagaaaagaaaatgaagaaagagagtataagaaaaaggagaaagcagaggcccac
atgttcactgcattaaaggttgcccgagattctgattttgcagagcaaattggaaaacat
atatattttgatcttgtggattatgacaacatccaaagccttcgggcacctaaacatttg
acaataaaccaggccaaggtcgatttatcaaaagaatttggtattcctgtacaatcccaa
cgattttggttatgggctaagcgacagaaccacacatttagacccgtacgcccgttgact
ctccaggaggaagcatctagtattggacaccttacagatccatcaaataaatcactcaat
tctgagttgaaactgttcttggaggttgcattgggacaggaaaatcatcctatttctgtg
cctccaaagacaaaggatgacatattaatattcttcaagctgtatgatcctgaaaaggaa
gagctaagatatgttggaaaacttcttgtgaaagcatcagggaagccagctgatatagtg
caaaaattgcaagagatggcagggtttcagtcagatgaagatattgaactgtatgaggaa
gtaatgttcgagccaagtgtaatgtgtgaacctattaacattaatgattccttcctttca
agccagcttgaagatggtgacattatatgctaccaaaaacgttgttctccagaaaagttg
gaccactatcgctgtgccgatgtgccatctttctttgaatatatccaaaatagacaggtt
gtccacttcagattacttgagaatccaaaagatgatgacttcactttggagctttcaaag
cgtttcacgtatgatgatgttgttgaaaaagttgctaatcaacttggactcgatgatcct
tccaaactccgccttacacaacacctcccgtattcacagatgcccaaatctcactacatt
aagtatagaggtcttgatcatctttcggacatgctaaggaatggcaatcagatgtctgac
atattgtattatgagatactggacatccctttgccagtactgcaagatctgataacattg
agagttgccttttatcatgctacaaacaatgaggtgtcatctcactttatacggttgcca
aaaggtagcactatgtctgatttgattgaggacatgaaatccaaggttgagttatcttat
agtgatgctgaattccggttatttgaggtctacaaaaacaagatacgcaaggtgtatcaa
ccttcggagaaaatttcagttaatgaattcaatggactgttatgtgttgaagaggttcct
gaagaagagaaaaatgctggtgtgcgagaccgtttggttcatgtctgtcacttcatcata
gaaaaacagcacattgattactacggagaacctttcttctttcttatccgtgatggtgag
acattatcagatatcaaagtgcgtattcagaagaaacttctggtttctgatgagcagttt
gcgaagtggaaatttgcttatattgctcacaatcgcctggctggtgaatactttcaagat
tcagatatcgtattgagccgattccagaaagatgtttatggaccatgggaacaatgccta
ggacttgagcactcagacgtcaccccaaaaaggtcatgcttgtccaatcagaaccgcaat
tctttcgataaggctgtgaagattttcaactag

DBGET integrated database retrieval system