KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324793Help
Entry
4324793           CDS       T01015                                 

Definition
Os01g0865100
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4324793
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    4324793
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     4324793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 307 aa AA seqDB search
MADRLELQGRHGKSRVRVSRVWRRPAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVA
TDSIKNTVYVKAKECTEIVSMEEFAVILGRHFTSLYPQVSEATVTIAERPWERVVVDGKP
HSHGFKLGVEKHVTEVIVKKSGNLLINSGIQGYSLLKTTQSGFEKFVRDRYTLLPDTRER
IVATEVTAWWRYPFEHVSQIPSKSFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQNTLY
LMAKEVLNRFPDIASVQLRMPNLHFIPVNLGNKENPGLVKFADDVYLPTDEPHGTIEATV
SRPKSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcgcctcgagctccagggcaggcacggcaagtcccgcgtccgcgtctcccgc
gtctggcgccgccccgcggccgcgggaggccacgtcatcgtcgagtggaacgtggccgtc
agcgtcgtctccgactgcctcccctcctacacctccgacgacaactccgccatcgtcgcc
accgattccatcaagaacaccgtgtatgtgaaggccaaggaatgcacggagattgtctcc
atggaggaattcgcggtgattcttggaaggcatttcacctcgctgtacccgcaggtctca
gaggcaacggtgaccatcgccgagcgtccatgggagcgtgtggttgtcgatgggaagcct
cattcccacgggttcaaacttggtgttgagaagcacgtcacagaggtcattgtgaagaag
tctggaaacttgctcataaattctggaatccaaggatactccctgctaaagacaactcag
tccgggttcgaaaaatttgtgagggatcgctacacacttcttcctgatacaagagaaagg
attgtagcaacagaagtaactgcctggtggaggtatccttttgagcatgtttcccagatt
ccatcaaagtcattctgcttcacacaaaggtatcaggacgtaaagaaagttcttgcagat
acgttctttggtcctcctgatgttggagtgtatagtccatcagtgcagaatacactatac
ctgatggctaaggaagttctcaacaggttcccggatatagcatctgttcagctaaggatg
ccgaacctccactttatccctgttaacttagggaacaaagaaaatccaggattagtgaag
tttgctgatgatgtgtacctgccgaccgatgaaccacacgggaccattgaagcaacagtg
agccgccccaagtcaaagttgtaa

DBGET integrated database retrieval system