KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324793Help
Entry
4324793           CDS       T01015                                 

Definition
Os01g0865100
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:osa00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:osa00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 307 aa AA seqDB search
MADRLELQGRHGKSRVRVSRVWRRPAAAGGHVIVEWNVAVSVVSDCLPSYTSDDNSAIVA
TDSIKNTVYVKAKECTEIVSMEEFAVILGRHFTSLYPQVSEATVTIAERPWERVVVDGKP
HSHGFKLGVEKHVTEVIVKKSGNLLINSGIQGYSLLKTTQSGFEKFVRDRYTLLPDTRER
IVATEVTAWWRYPFEHVSQIPSKSFCFTQRYQDVKKVLADTFFGPPDVGVYSPSVQNTLY
LMAKEVLNRFPDIASVQLRMPNLHFIPVNLGNKENPGLVKFADDVYLPTDEPHGTIEATV
SRPKSKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcgcctcgagctccagggcaggcacggcaagtcccgcgtccgcgtctcccgc
gtctggcgccgccccgcggccgcgggaggccacgtcatcgtcgagtggaacgtggccgtc
agcgtcgtctccgactgcctcccctcctacacctccgacgacaactccgccatcgtcgcc
accgattccatcaagaacaccgtgtatgtgaaggccaaggaatgcacggagattgtctcc
atggaggaattcgcggtgattcttggaaggcatttcacctcgctgtacccgcaggtctca
gaggcaacggtgaccatcgccgagcgtccatgggagcgtgtggttgtcgatgggaagcct
cattcccacgggttcaaacttggtgttgagaagcacgtcacagaggtcattgtgaagaag
tctggaaacttgctcataaattctggaatccaaggatactccctgctaaagacaactcag
tccgggttcgaaaaatttgtgagggatcgctacacacttcttcctgatacaagagaaagg
attgtagcaacagaagtaactgcctggtggaggtatccttttgagcatgtttcccagatt
ccatcaaagtcattctgcttcacacaaaggtatcaggacgtaaagaaagttcttgcagat
acgttctttggtcctcctgatgttggagtgtatagtccatcagtgcagaatacactatac
ctgatggctaaggaagttctcaacaggttcccggatatagcatctgttcagctaaggatg
ccgaacctccactttatccctgttaacttagggaacaaagaaaatccaggattagtgaag
tttgctgatgatgtgtacctgccgaccgatgaaccacacgggaccattgaagcaacagtg
agccgccccaagtcaaagttgtaa

DBGET integrated database retrieval system