KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324880Help
Entry
4324880           CDS       T01015                                 

Definition
Os01g0885000
Orthology
K08738  
cytochrome c
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    4324880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 111 aa AA seqDB search
MATFSDAPPGDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSG
DKIVPVIWEENTLYDYLLTPKKYTPAKMGFNGLKQPQDRADLIAYLKNATA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattctccgatgcgccgcccggggacgcggcggccggcgagaagatcttcagg
accaagtgcgcgtactgccatgccgtcgacaaggccgccggccacaagcatgggccaaac
ttgaacggtttgtttgggaggcaatctggtacagctcctggtttctcttacccatctggc
gacaagatagtgcctgtgatttgggaagagaacactttgtatgactacctgcttactcct
aagaagtacactcctgccaagatggggttcaatggactgaagcagccacaggaccgtgct
gatctcatcgcatacctgaagaacgccacagcatga

DBGET integrated database retrieval system