KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324914Help
Entry
4324914           CDS       T01015                                 

Definition
Os01g0891000
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4324914
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4324914
   00603 Glycosphingolipid biosynthesis - globo series
    4324914
   00604 Glycosphingolipid biosynthesis - ganglio series
    4324914
   00511 Other glycan degradation
    4324914
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     4324914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 526 aa AA seqDB search
MAQALSLGLLLAFLAIQSCIAIELTDHIDLWPMPTSVSHGTQRLYVSKDITMSMEGSTYP
DGKGILKDAFQRVVDLMKLNHVVDGANPSSFVLTGVNVVVHSPEDELKFGVDESYNLSVP
TAGYPLRVQIEAQTVFGALHALQTFSQLCYFDFTSKLIELISAPWRISDTPRFPYRGLLI
DTSRHYLPVTVIKKVIDTMAYSKLNVLHWHIVDAQSFPIEIPSYPKLWNGSYSFSERYTT
SDAVDIVRYAENRGVNVMAEIDVPGHALSWGVGYPSLWPSDSCKEPLDVSNNFTFGVIDG
ILSDFSKVFKFKFVHLGGDEVNTSCWTATPHIKKWLDDNQMNVSDAYRYFVLRSQKLAIS
HGYDVINWEETFNNFGDKLDRRTVVHNWLGEDVAPKVVAAGLRCIVSNQDKWYLDHLDAT
WEGFYTNEPLKGIDDPEQQSLVIGGEVCMWGEQIDASDIEQTIWPRAAAAAERLWTPIEK
IAEDPRLVTSRLARFRCLLNQRGVAAAPVAGYGRTAPYEPGPCVRQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggctctgagtttggggttgcttcttgcgtttctggcaattcaatcctgcatc
gccattgagctgactgatcacatcgacttgtggcctatgccaacgtcggtgagccatgga
acacaaagactttatgtcagcaaagatatcacaatgtcaatggagggaagcacgtatcct
gacgggaaagggatcttgaaggatgccttccagagggtagttgatttaatgaaactgaac
catgtcgttgatggtgcaaacccaagttcttttgtactcactggtgtaaatgtagttgtc
cattcacctgaagatgagctcaaattcggagtagatgaatcatataacttatctgttcct
acagcaggatatccattgcgcgtacagattgaggctcaaacagtatttggagcacttcat
gctttacagacatttagccaactgtgttacttcgatttcacatcaaaacttatagaactc
atctcggctccttggagaatttctgacacaccaagatttccttaccgaggacttcttatt
gatacctcaaggcactaccttcctgttacggtaattaaaaaagtgattgatacaatggcc
tacagtaaattgaacgttctccattggcatattgtggatgcacagtcatttcccattgaa
ataccttcataccctaaactgtggaacggttcatattctttttcagagagatatacgacg
tctgatgctgtagacattgtacgatatgctgaaaatcgaggtgtaaatgttatggctgag
attgatgttcctggtcatgctctgtcatggggcgttggctacccatcattgtggccatca
gatagctgcaaagaaccacttgatgtcagtaacaacttcacgtttggagttattgatgga
attctttcagattttagcaaagtttttaaattcaaatttgtgcatttaggaggtgatgaa
gtcaacacaagctgctggactgcaacaccccacattaagaaatggttggatgataaccaa
atgaatgtgtcagatgcatacagatattttgtgttgagatcccaaaagctagcaatatca
cacggttatgatgtcatcaactgggaggaaacatttaacaattttggagacaaattggac
cgtagaaccgtggttcataactggcttggagaggatgtagcaccaaaagtggttgcggca
gggctgagatgcatcgtaagcaaccaggataagtggtacctagatcacttagatgccaca
tgggaggggttttacacgaatgaacctctgaaaggtattgacgacccagagcagcaaagt
ttggtcattggtggtgaggtttgtatgtggggcgaacaaattgacgcatcggatattgaa
caaaccatttggccacgtgctgcagctgctgcagagagactatggactcctattgagaag
attgcagaagacccaagattggtcacgtcaagattggcacgcttcaggtgtttgctgaac
caaagaggggtagctgctgcaccggtggctgggtatggccgtacagcaccatatgaacct
ggtccctgtgtaaggcaatag

DBGET integrated database retrieval system