KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325003Help
Entry
4325003           CDS       T01015                                 

Gene name
20ox2, C20ox2, GA20, Os20ox2, SD1-2E, Sd-1, osGA20ox2, sd1
Definition
(RefSeq) gibberellin 20 oxidase 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 389 aa AA seqDB search
MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAE
LDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFR
LPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGP
DFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEP
ERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRY
KSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRA
DTRTLDAFTRWLAPPAADAAATAQVEAAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccacc
gccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagccc
aagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggag
ctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgc
cgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgag
cacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgc
ctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacacc
agcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggc
ttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggcccc
gacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcg
ctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggag
ttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccg
gagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccag
gacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtc
cccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtat
aagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttc
ttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcag
cactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgcc
gacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgcc
gcgacggcgcaggtcgaggcggccagctga

DBGET integrated database retrieval system