KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325211Help
Entry
4325211           CDS       T01015                                 

Definition
(RefSeq) Os01g0147900
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4325211
   01230 Biosynthesis of amino acids
    4325211
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4325211
   00051 Fructose and mannose metabolism
    4325211
   00562 Inositol phosphate metabolism
    4325211
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325211
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4325211
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4325211
  Exosomal proteins of bladder cancer cells
   4325211
  Exosomal proteins of melanoma cells
   4325211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAISERIKDWTNVVVAYEPVWAIGTGKVATPD
QAQEVHDGLRKWLAANVSAEVAESTRIIYGGSVTGANCKELAAKPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaacgggaccactgatcaggtg
gacaaaattgtgaaaattctgaatgagggacagattgcttctacagatgttgttgaggtg
gttgtcagcccaccttatgtgttccttcccgtggtcaagagtcagctgcgcccggagatc
caagttgctgctcagaattgttgggtgaagaagggcggggctttcaccggtgaggtcagc
gctgagatgcttgtcaaccttagtattccctgggttattcttggacactctgaaaggagg
agtttgttgggtgaatcaaatgagtttgttggagacaaagtggcatatgcgctctctcag
ggcttgaaggtcattgcatgtgttggtgagactctcgagcagcgggaatctggttcgacc
atggatgttgttgctgcacaaacaaaagcaatttctgaaaggatcaaggattggactaat
gtggttgttgcctatgaacctgtgtgggccattggaactggtaaagttgctacaccagat
caagcacaagaagtgcatgatggcctgaggaagtggctcgctgctaatgtcagtgcagag
gttgctgaatcaacaaggatcatctatggaggttccgtaactggtgcgaactgcaaggag
ctggcagcaaagcctgatgttgatggttttctcgtcggtggtgcttcattgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtccgcctaa

DBGET integrated database retrieval system