KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325211Help
Entry
4325211           CDS       T01015                                 

Gene name
P0434B04.9, Rictpi2
Definition
(RefSeq) triosephosphate isomerase, cytosolic
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4325211 (P0434B04.9)
   01230 Biosynthesis of amino acids
    4325211 (P0434B04.9)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4325211 (P0434B04.9)
   00051 Fructose and mannose metabolism
    4325211 (P0434B04.9)
   00562 Inositol phosphate metabolism
    4325211 (P0434B04.9)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4325211 (P0434B04.9)
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4325211 (P0434B04.9)
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4325211 (P0434B04.9)
  Exosomal proteins of bladder cancer cells
   4325211 (P0434B04.9)
  Exosomal proteins of melanoma cells
   4325211 (P0434B04.9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 253 aa AA seqDB search
MGRKFFVGGNWKCNGTTDQVDKIVKILNEGQIASTDVVEVVVSPPYVFLPVVKSQLRPEI
QVAAQNCWVKKGGAFTGEVSAEMLVNLSIPWVILGHSERRSLLGESNEFVGDKVAYALSQ
GLKVIACVGETLEQRESGSTMDVVAAQTKAISERIKDWTNVVVAYEPVWAIGTGKVATPD
QAQEVHDGLRKWLAANVSAEVAESTRIIYGGSVTGANCKELAAKPDVDGFLVGGASLKPE
FIDIINSATVKSA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcaagttcttcgttggtggcaactggaaatgcaacgggaccactgatcaggtg
gacaaaattgtgaaaattctgaatgagggacagattgcttctacagatgttgttgaggtg
gttgtcagcccaccttatgtgttccttcccgtggtcaagagtcagctgcgcccggagatc
caagttgctgctcagaattgttgggtgaagaagggcggggctttcaccggtgaggtcagc
gctgagatgcttgtcaaccttagtattccctgggttattcttggacactctgaaaggagg
agtttgttgggtgaatcaaatgagtttgttggagacaaagtggcatatgcgctctctcag
ggcttgaaggtcattgcatgtgttggtgagactctcgagcagcgggaatctggttcgacc
atggatgttgttgctgcacaaacaaaagcaatttctgaaaggatcaaggattggactaat
gtggttgttgcctatgaacctgtgtgggccattggaactggtaaagttgctacaccagat
caagcacaagaagtgcatgatggcctgaggaagtggctcgctgctaatgtcagtgcagag
gttgctgaatcaacaaggatcatctatggaggttccgtaactggtgcgaactgcaaggag
ctggcagcaaagcctgatgttgatggttttctcgtcggtggtgcttcattgaagcctgaa
ttcatcgacatcatcaactccgccaccgtgaagtccgcctaa

DBGET integrated database retrieval system