KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325332Help
Entry
4325332           CDS       T01015                                 

Definition
Os01g0183000
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325332
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     4325332
    2.7.1.82  ethanolamine kinase
     4325332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 367 aa AA seqDB search
MVAVDPPPREAAAAPPAMKRSASFDRVPEEARRILHRLAGELWGGDVDPAALAVSQLKGA
MTNEVFRITWPGGGGGEGEGEGDHRKVLVRIYGQGVEVFFDRADEVRTFECMSRHGQGPR
LLGRFPNGRIEEFINARTLSAADLRDAEISSLIAKKLREFHDLDMPGPKNVSLWQRLRRW
LEEARGRCSPEEARQFSLEKLGDEIAMLDIALSGVDQRVGFCHNDLQYGNIMIYEETRQV
TLIDYEYASFNPVAFDIANHFCEMSADYHSATPHVLDFTKYPGIDEQRRFVQTYLSSSGE
NPSDAEVEHLLGLIAKYSLASHIFWGLWGIISGHVNKNIDFEYQEYARQRFDQYWKTKDQ
TLGSKSN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgtcgacccgccgccgcgggaggccgcggccgccccgcccgccatgaagcgg
agcgcgagcttcgaccgcgtcccggaggaggcgcgccgcatcctgcaccgcctcgccggg
gagctctggggcggcgacgtcgaccccgccgcgctcgccgtgtcccagctcaagggcgcc
atgaccaacgaggtgttccggatcacctggcccggcggcggcggcggcgagggcgagggc
gagggcgaccaccgcaaggtgctcgtccgcatctacggccagggcgtcgaggtcttcttc
gaccgcgccgacgaggtccgcaccttcgagtgcatgtcccgccacggccagggcccccgc
ctcctcggccgcttccccaacggccgcatcgaggagttcatcaacgcgaggacgctctcc
gcggcggatctgcgcgacgcggagatatcctcgctgatcgccaagaagcttcgtgaattc
cacgatctcgacatgcctggacccaagaacgtgtcactgtggcagaggctgaggaggtgg
cttgaggaagctcgtggcaggtgctcgcccgaggaggctaggcagttcagtttggagaag
ctaggtgatgagatcgcaatgctggacattgcattgtcaggggttgatcagagagtagga
ttttgccacaatgatctgcaatatggcaacattatgatatatgaagaaaccagacaagtg
accttaattgactacgagtatgcgagttttaatcctgtggcatttgacattgctaatcac
ttctgtgagatgtctgctgattatcattcagccacacctcatgtgctggacttcacaaaa
taccctggcattgacgaacaacgcagatttgttcaaacgtacctcagctcttcaggtgag
aacccatcagatgcggaagttgaacatttacttggcctgattgcaaaatacagtcttgca
agccatatcttctggggtctttggggaataatctcagggcatgtgaacaagaacatcgac
ttcgagtaccaggagtatgcaaggcagcggttcgatcagtactggaagacaaaagatcaa
acgctgggatccaaatccaactag

DBGET integrated database retrieval system