KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325586Help
Entry
4325586           CDS       T01015                                 

Definition
Os01g0717000
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:osa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 368 aa AA seqDB search
MVAIENQSQGQRAAEAAAQPRIPREARRLLHEMAASWADVADCRALQVIPLKGAMTNEVY
QVRWLNGAPATADGGEVEAEAAAREREVRKVLVRIYGDGVELFFDREDEVRTFECMSRHG
QGPRLLGRFTNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIWDR
LKNWLKTARNLCSSDESKKFRLGSLENEIAALEKEFSGDYHGIGFCHNDLQYGNIMIDED
TNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHRLDYSKYPDTDEQKRFVKTYLS
NSVSEEPDAEEVENLLQSIEKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYWQ
KKQALLTS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagagccagggccagcgggcggcggaggcggcggcgcagcca
cggatccccagggaggcgcggcggctactgcacgagatggcggcgtcgtgggcggacgtt
gccgactgccgggcgctgcaggtgattccgctcaagggcgccatgaccaacgaggtgtac
caggtgcgctggctcaacggcgccccggccaccgccgacggcggcgaggtggaggcggag
gcggccgcaagggagagggaggtgaggaaggtcctcgtgcggatatacggcgacggcgtg
gagctcttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtctcgccatggc
caaggcccccgcctcctcggccggttcaccaacggccgcgtcgaggagttcatccacgca
aggacactatctgcagcagaccttcgtgatcctgaaatttcagctctggtggcgtcaaaa
ctgagggaattccacaaccttgacatgcctggcccgaaatctgtactcatttgggaccga
ctgaaaaactggctcaaaactgcaaggaacctgtgctcatctgatgaatccaagaaattt
cggctgggtagcctggagaacgagattgctgcattggagaaagaattttcaggggattac
cacgggattggtttttgccacaacgatcttcagtatggcaacatcatgattgatgaagac
accaacatgttgactatcatcgattatgaatatgccagcttcaatccagttgcgtatgac
atcgctaatcatttctgcgagatggcagcagactatcattcagagaagccacatagactg
gactacagtaaatatccagacactgatgagcagaagcgttttgtgaagacgtacctaagc
aattctgtaagtgaagaacctgatgcggaagaggtggagaaccttctccaaagcattgag
aaatacacgctcgccagtcatctagtttggggcctctggggaataatatcggatcatgtc
aatgatattgacttcgactacaaggagtatgcaaggcagagattcgagcagtattggcag
aagaagcaagcacttttaacttcatga

DBGET integrated database retrieval system