KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325651Help
Entry
4325651           CDS       T01015                                 

Gene name
P0431H09.7
Definition
(RefSeq) threonine synthase, chloroplastic
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4325651 (P0431H09.7)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4325651 (P0431H09.7)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4325651 (P0431H09.7)
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4325651 (P0431H09.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 525 aa AA seqDB search
MATATASSLSLLFAHPHSSNPRPFAGGPHLRRPLRAAPHRARCASDAATTATRHRRPAEE
NIREEAARLRGPGNDFSAWYVPFPPTPEDDPDERYSLDEVVYRSSSGGLLDVCHDMEALA
RFPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLFWAERLGR
EHLGGMTDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPINGVGCASTGDTSAA
LSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIY
LANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDR
VPRLVCAQAANANPLYRFYKSGWTDFQPRVAETTFASAIQIGDPVSVDRAVVALKATDGI
VEEATEEELMDAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKF
TQSKIDYHDRNIKDMLCQYANPPINVKADFASVMDVLQNKLNGKI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccaccgcgtcgtccctctctctcctcttcgcccacccacactcgtccaac
cccaggcccttcgccggcgggcctcacctccgccgcccgctgcgcgccgcgccccaccgc
gcgcgatgcgcctccgacgccgccacgacggccacgaggcaccgccgccccgcggaggag
aacatccgggaggaggccgcgcggctccgcggccccgggaacgacttctcggcgtggtac
gtgccgttccccccgacgcccgaggacgaccccgacgagcgctactcgctggacgaggtg
gtctaccgctccagctccggggggctcctcgacgtgtgccacgacatggaggcgctcgcg
cgcttcccgggctcctactggcgcgacctcttcgactcccgcgtggggcgcaccgcgtgg
ccctacggctccggggtgtggtccaagaaggagttcgtgctcccggagatcgactccgac
cacatcgtctccctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgc
gagcacctcggcgggatgaccgacctctgggttaagcactgcggcatctcgcacacgggc
tccttcaaggacctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcg
ccgctctcacgccccatcaacggcgtcggctgcgcgtccacgggcgacacctccgccgcg
ctttccgcgtactgcgccgccgcaggtatccccgccatcgtgttcctccccgccgaccgc
atctctctgcagcagctcatccagccaatcgccaacggcgccaccgtgctctcgctggac
acggactttgacgggtgcatgcggctcatcagggaggtgaccgccgagctaccgatttac
cttgccaactcgctgaactcccttcggcttgagggccagaagacggcagccatcgagata
ttgcagcagttcgattggcaggtgccggattgggtcattgttccaggaggcaatcttggg
aatatctatgccttctacaaggggtttgagatgtgccgtgttcttgggcttgttgatcgt
gtgccgcgtcttgtatgcgcacaagctgcaaacgcaaatccgttgtatcggttctacaag
tcagggtggactgatttccagccacgtgtagccgaaactacatttgcatctgccatacag
attggtgatccagtatctgtcgaccgtgcagtggtcgccctgaaggcaactgacggtatt
gttgaggaagctacggaggaagaactcatggatgcaatgtcacttgctgaccgcaccgga
atgtttgcctgcccacacaccggggttgcacttgctgctttgttcaagcttcgagaccag
cgcataatcgggcctaatgaccgcacagtggttgttagtacagcgcatgggcttaagttc
acacaatcgaagatagactaccatgacaggaacatcaaggacatgctgtgccagtacgct
aatccaccaatcaatgtgaaggctgactttgcttctgtgatggatgttctccagaacaag
ctgaatggtaagatctga

DBGET integrated database retrieval system