KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325651Help
Entry
4325651           CDS       T01015                                 

Definition
Os01g0693800
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4325651
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4325651
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4325651
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4325651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 548 aa AA seqDB search
PSSSLITPPIPSSSAAKHLASSAMATATASSLSLLFAHPHSSNPRPFAGGPHLRRPLRAA
PHRARCASDAATTATRHRRPAEENIREEAARLRGPGNDFSAWYVPFPPTPEDDPDERYSL
DEVVYRSSSGGLLDVCHDMEALARFPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEI
DSDHIVSLFEGNSNLFWAERLGREHLGGMTDLWVKHCGISHTGSFKDLGMTVLVSQVNRL
RRAPLSRPINGVGCASTGDTSAALSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVL
SLDTDFDGCMRLIREVTAELPIYLANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGG
NLGNIYAFYKGFEMCRVLGLVDRVPRLVCAQAANANPLYRFYKSGWTDFQPRVAETTFAS
AIQIGDPVSVDRAVVALKATDGIVEEATEEELMDAMSLADRTGMFACPHTGVALAALFKL
RDQRIIGPNDRTVVVSTAHGLKFTQSKIDYHDRNIKDMLCQYANPPINVKADFASVMDVL
QNKLNGKI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
ccatcctcctccctaattactccccccatcccctcctcctccgccgccaagcacctcgcc
tcctccgccatggcgaccgccaccgcgtcgtccctctctctcctcttcgcccacccacac
tcgtccaaccccaggcccttcgccggcgggcctcacctccgccgcccgctgcgcgccgcg
ccccaccgcgcgcgatgcgcctccgacgccgccacgacggccacgaggcaccgccgcccc
gcggaggagaacatccgggaggaggccgcgcggctccgcggccccgggaacgacttctcg
gcgtggtacgtgccgttccccccgacgcccgaggacgaccccgacgagcgctactcgctg
gacgaggtggtctaccgctccagctccggggggctcctcgacgtgtgccacgacatggag
gcgctcgcgcgcttcccgggctcctactggcgcgacctcttcgactcccgcgtggggcgc
accgcgtggccctacggctccggggtgtggtccaagaaggagttcgtgctcccggagatc
gactccgaccacatcgtctccctcttcgagggcaactccaacctcttctgggcggagcgc
ctcggccgcgagcacctcggcgggatgaccgacctctgggttaagcactgcggcatctcg
cacacgggctccttcaaggacctcggcatgacggtgctcgtcagccaggtgaaccgcctc
cgccgcgcgccgctctcacgccccatcaacggcgtcggctgcgcgtccacgggcgacacc
tccgccgcgctttccgcgtactgcgccgccgcaggtatccccgccatcgtgttcctcccc
gccgaccgcatctctctgcagcagctcatccagccaatcgccaacggcgccaccgtgctc
tcgctggacacggactttgacgggtgcatgcggctcatcagggaggtgaccgccgagcta
ccgatttaccttgccaactcgctgaactcccttcggcttgagggccagaagacggcagcc
atcgagatattgcagcagttcgattggcaggtgccggattgggtcattgttccaggaggc
aatcttgggaatatctatgccttctacaaggggtttgagatgtgccgtgttcttgggctt
gttgatcgtgtgccgcgtcttgtatgcgcacaagctgcaaacgcaaatccgttgtatcgg
ttctacaagtcagggtggactgatttccagccacgtgtagccgaaactacatttgcatct
gccatacagattggtgatccagtatctgtcgaccgtgcagtggtcgccctgaaggcaact
gacggtattgttgaggaagctacggaggaagaactcatggatgcaatgtcacttgctgac
cgcaccggaatgtttgcctgcccacacaccggggttgcacttgctgctttgttcaagctt
cgagaccagcgcataatcgggcctaatgaccgcacagtggttgttagtacagcgcatggg
cttaagttcacacaatcgaagatagactaccatgacaggaacatcaaggacatgctgtgc
cagtacgctaatccaccaatcaatgtgaaggctgactttgcttctgtgatggatgttctc
cagaacaagctgaatggtaagatctga

DBGET integrated database retrieval system