KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325716Help
Entry
4325716           CDS       T01015                                 

Definition
Os01g0372500
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4325716
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     4325716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 375 aa AA seqDB search
MTDVELRVEALSLSGVSAIPPEYVRPEEERADLGDALELARAASDDDATARIPVVDISAF
DNDGDGRHACVEAVRAAAEEWGVIHIAGHGLPGDVLGRLRAAGEAFFALPIAEKEAYAND
PAAGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRV
RTLASKLLAILSLGLGLPEETLERRLRGHELAGVDDDLLLQLKINYYPRCPRPDLAVGVE
AHTDVSALSFILHNGVPGLQVHHAGSWVTARPEPGTIVVHVGDALEILTNGRYTSVLHRG
LVSRDAVRLSWVVFCEPPPESVLLQPVPELLADGADKPLFAPRTFKQHVQRKLFEKLKDQ
QDNNAAAASNGMRTK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtggagctgagagtggaggccctcagcctcagcggcgtctccgccatcccg
ccggagtacgtccgcccggaggaggagcgcgccgacctcggcgacgccctggagctcgcc
cgggccgcgtccgacgacgacgccaccgcccgcatccccgtcgtcgacatctccgcgttc
gacaacgacggcgacggcaggcacgcgtgcgtggaggcggtgcgcgcggcggcggaggag
tggggcgtcatacacatcgccggccacggcctcccgggcgacgtcctcggccgcctgcgc
gccgcgggcgaggcgttcttcgcgctgcccatcgcggagaaggaggcgtacgccaacgac
ccggcggcggggcggctgcaggggtacggcagcaagctcgccgccaacgccagcgggaag
agggagtgggaggactacctgttccacctcgtccacccggaccacctcgccgaccactcg
ctctggccggcgaacccgccggagtacgtccccgtgtcgcgcgacttcggcggccgcgtc
cggaccctcgcatccaagctgctcgccatcctctccctcggcctcggcctgccggaagag
acgctggaacgccgcctgagaggacatgagctggccggcgtcgacgacgacctgctcctt
cagctcaagatcaactactacccgaggtgcccgcggcctgacctcgccgtcggcgtcgag
gcacacaccgacgtcagcgcgctctccttcatcctccacaacggcgtgccggggctgcag
gtgcaccacgccgggagctgggtcaccgcgcgccccgagccgggcaccatcgtcgtccac
gtcggcgacgccctggagatcctcaccaacggccggtacaccagcgtgctccaccgcggc
ctcgtcagccgcgacgccgtgcgcctctcctgggtcgtcttctgcgagccgccgcctgag
tccgtgctgctgcagccggtgccggagctgctcgccgacggcgccgacaagccgctcttc
gcgccgcgcacattcaagcagcacgtgcaacgcaagctgttcgagaagctcaaggatcag
caagacaacaatgccgcagctgcatcgaacggaatgagaactaaataa

DBGET integrated database retrieval system