KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325748Help
Entry
4325748           CDS       T01015                                 

Definition
Os01g0952600
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4325748
  Lipid metabolism
   00600 Sphingolipid metabolism
    4325748
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4325748
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     4325748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1117 aa AA seqDB search
MAVASASALFSAKNLPHKPWEDPSFFRWRKREAHVPLRSHDTPEGALKYWHERRNVNYLN
SDSAVWNDDAVRGALESAAFWSKGLPYVQTLSGYWKFLLASSPESVPEKFYDAYFNDSDW
EALPVPSNWQMHGFDRPIYTNVTYPFTMNPPFVPNDNPTGCYRTVFRIPKEWKGRRILLH
FEAVDSAFFAWVNGVPVGYSQDSRLPAEFEITDFCHPCDSEKENVLAVQVMRWSDGSYLE
DQDHWWLSGIHRDVLLVSKPQIFITDYFFKATLDEGFRVADIEVEVEIDSQKQDREHVST
LSIEATLYDNYGPADVLTSDMSAASVANLKLKPASRPKHCYGFHGYVLGGKVENPKLWSS
EHPNLYTLVVVLKDSNGKLIECESCQVGIRNVVLAHKQMLVNGCPVVIRGVNRHEHHPRV
GKTNLEACMIKDLVLMRQNNINAVRNSHYPQHPRWYELCDIFGLYVIDEANIETHGFDES
SHFKHPTLEPFWASAMLDRVVGMVERDKNHACIIVWSLGNESSYGPNHSAMSGWIRGKDP
TRPIHYEGGGSRTSSTDIVCPMYMRVWDILKIAQDPSENRPLILCEYSHAMGNSNGNIDA
YWMAIDNTVGLQGGFIWDWVDQGLLKEDADGSKNWAYGGDFGDTPNDLNFCLNGIVWPDR
TIHPAVHEVKYLYQPIKITMMDNMLKIENVHFFETTEALDFSWLLQGDGCALGSGSLNVP
SIAPQSTHLINMKSSPWFTIWSTCVVKEIFLSINVKLRYQTQWAKDGHILASAQICLPPK
KGFVPHAIALPRSSLVSERVGDHVLISKSNAWQIKVNSISGTIDSWKVNNIELMSKGIHP
CFWRTPTDNDKGGFYTKPYVSRWREASLDNISFYSSQFSLKELPDQTVEISTIYYGLPGN
QPKPDETSLSDESESVLFRVQMRGRIYDSGDVILDYEVSPKNDLPPLPRVGVVFNADKSL
SRAKWYGRGPFECYPDRKAAAHVGVYESGVDELHVPYIVPGECGGRADVRWVALQDADGF
GLFASAYGESPPMQVSASYYGAAELDRATHNHKLVKGDDIEVHLDHKHMGLGGDDSWSPC
VHEQYLLPPARYAFSVRLCPLLPSSSCHDIYHSQLPC
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagcttctgccagtgcactgttttccgccaagaatcttccgcataaaccctgg
gaggacccgtcattctttaggtggagaaagcgggaggctcatgtgccgttgcgctcacat
gacacacctgaaggagccctcaagtattggcatgaacggaggaatgtgaactatcttaat
tctgactctgctgtttggaatgatgacgcggttcgtggtgccctggaaagtgctgcgttt
tggtccaagggcttgccatatgtccagactctaagtggatactggaagttccttttggct
tcctcgccagaatctgttccagagaaattctatgatgcctacttcaatgattcagattgg
gaggctttgccagttccctcaaactggcaaatgcatgggtttgaccgtccaatctacaca
aatgtcacttatcctttcaccatgaacccgccatttgtgccaaatgataatcctactggc
tgttataggacggtttttcgcatcccaaaagagtggaaaggtcgaagaatcttgttgcac
tttgaagctgttgattcagcgttttttgcttgggtaaacggcgttcctgttggatatagc
caggacagcaggcttcctgctgagtttgagatcacagatttctgccatccttgtgactca
gaaaaggaaaatgttcttgctgttcaagtgatgaggtggagtgacggttcctatcttgaa
gaccaggaccattggtggctatctggtattcacagggatgttctactagtatcaaagcca
cagatctttattacagattattttttcaaagcaaccttggatgaaggcttccgtgtagct
gatattgaggttgaggtggaaattgactcacaaaagcaggatcgggagcatgtctcaact
ttgtctattgaagcaacattgtatgacaattatggacctgctgatgttttaacttctgat
atgtctgctgctagtgtggccaatttgaagttgaagccagcttcaagaccaaaacactgt
tatggttttcatggttatgttcttggtggaaaagtagaaaatccaaaactttggtctagt
gaacatcccaacttatacactcttgttgttgtccttaaagattccaacgggaagctcatt
gagtgtgaatcatgccaagtaggaatccgtaatgtcgtcctggcacacaagcagatgctt
gtcaatggatgtcctgttgtaataagaggtgtcaacagacatgagcatcatccacgtgtt
ggaaagacaaatttagaagcttgcatgattaaggatctggttttgatgagacaaaacaac
attaatgctgttagaaacagccattatccccaacatccaaggtggtatgagctgtgtgac
atttttggactttatgtaattgatgaagccaacatcgagacgcatggctttgatgaatct
agccatttcaaacatcctacacttgaacccttctgggcaagtgctatgcttgatcgtgtt
gttggtatggtggagagagacaagaatcatgcatgcattatagtatggtccttgggaaat
gaatcttcgtatggaccaaatcactcagccatgtctggctggattcgtggaaaggacccg
acaaggcccatccattatgaaggaggtggttctagaacatcctccactgatattgtatgc
ccaatgtacatgcgtgtctgggatattcttaagatcgcacaagacccttctgaaaatagg
cccctcattctttgcgaatattcacatgctatgggaaacagtaatggaaatattgatgca
tattggatggccatagacaacactgttggactccaaggtggttttatatgggactgggtc
gatcagggtttactaaaggaagatgctgatggatctaaaaactgggcatatggtggcgac
tttggagacactccaaatgacttgaatttttgtcttaatggcattgtatggcctgatcgg
acaattcacccagctgtgcatgaagttaaatatttataccagcctatcaaaataacaatg
atggataacatgcttaagattgaaaacgtacatttttttgagacaacagaagctttggac
ttcagttggctacttcaaggagatggctgtgctttgggctctggttcacttaatgtccca
tccatagcaccacagagtactcatctgatcaatatgaagtcatcaccttggtttactatt
tggagtacttgtgtcgtaaaagaaatatttttgtccattaacgtgaaattgaggtaccaa
acacaatgggccaaagatggccatatcttggcttcagcacaaatttgtttacctccgaaa
aaaggctttgtccctcatgcgatagcactgcccaggagctctttggtttcggaacgtgtt
ggtgatcatgtactcatcagcaaaagtaatgcctggcaaatcaaagtaaacagtatttca
ggaacaatcgatagttggaaggtcaacaacattgagcttatgagcaagggaatacaccca
tgcttttggcgaacaccaactgacaacgacaagggaggcttctacaccaagccctatgtt
tcaagatggagagaagcttctctcgacaacatctcgttctacagcagccagttttctctg
aaggaattgccagaccaaaccgtcgagatctccaccatctactacggtcttcctgggaat
caaccaaagcctgatgaaacctctctctcagacgaatccgagtccgtcctcttccgggtg
cagatgcgcggccggatctacgactccggcgacgtgatcctggactacgaggtgagcccc
aagaacgacctgcctcctcttcctcgcgtcggcgtcgtgttcaacgccgacaagtccctg
agccgtgcaaaatggtacgggagggggccattcgagtgctacccggaccggaaggccgcc
gcgcacgtcggcgtgtacgagagcggcgtcgacgagctgcacgtgccgtacattgtcccc
ggcgagtgcggcggccgggctgacgtccggtgggtggcgctccaggacgccgacgggttc
ggcctcttcgcgtcggcctacggcgagtcgccgccgatgcaggtgagcgccagctactat
ggcgccgcggagctcgaccgcgcgacgcataaccacaagctcgtcaagggagacgacatc
gaggtgcatcttgatcacaagcacatggggctgggaggggacgacagctggtcgccgtgc
gtgcacgagcagtacttgctgccgccggcgagatacgccttctcggtgaggctgtgcccg
ttgctgccgtcgtcgtcgtgccatgacatctaccactctcagctaccctgttga

DBGET integrated database retrieval system