KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325748Help
Entry
4325748           CDS       T01015                                 

Definition
Os01g0952600
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:osa00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:osa00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:osa00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1117 aa AA seqDB search
MAVASASALFSAKNLPHKPWEDPSFFRWRKREAHVPLRSHDTPEGALKYWHERRNVNYLN
SDSAVWNDDAVRGALESAAFWSKGLPYVQTLSGYWKFLLASSPESVPEKFYDAYFNDSDW
EALPVPSNWQMHGFDRPIYTNVTYPFTMNPPFVPNDNPTGCYRTVFRIPKEWKGRRILLH
FEAVDSAFFAWVNGVPVGYSQDSRLPAEFEITDFCHPCDSEKENVLAVQVMRWSDGSYLE
DQDHWWLSGIHRDVLLVSKPQIFITDYFFKATLDEGFRVADIEVEVEIDSQKQDREHVST
LSIEATLYDNYGPADVLTSDMSAASVANLKLKPASRPKHCYGFHGYVLGGKVENPKLWSS
EHPNLYTLVVVLKDSNGKLIECESCQVGIRNVVLAHKQMLVNGCPVVIRGVNRHEHHPRV
GKTNLEACMIKDLVLMRQNNINAVRNSHYPQHPRWYELCDIFGLYVIDEANIETHGFDES
SHFKHPTLEPFWASAMLDRVVGMVERDKNHACIIVWSLGNESSYGPNHSAMSGWIRGKDP
TRPIHYEGGGSRTSSTDIVCPMYMRVWDILKIAQDPSENRPLILCEYSHAMGNSNGNIDA
YWMAIDNTVGLQGGFIWDWVDQGLLKEDADGSKNWAYGGDFGDTPNDLNFCLNGIVWPDR
TIHPAVHEVKYLYQPIKITMMDNMLKIENVHFFETTEALDFSWLLQGDGCALGSGSLNVP
SIAPQSTHLINMKSSPWFTIWSTCVVKEIFLSINVKLRYQTQWAKDGHILASAQICLPPK
KGFVPHAIALPRSSLVSERVGDHVLISKSNAWQIKVNSISGTIDSWKVNNIELMSKGIHP
CFWRTPTDNDKGGFYTKPYVSRWREASLDNISFYSSQFSLKELPDQTVEISTIYYGLPGN
QPKPDETSLSDESESVLFRVQMRGRIYDSGDVILDYEVSPKNDLPPLPRVGVVFNADKSL
SRAKWYGRGPFECYPDRKAAAHVGVYESGVDELHVPYIVPGECGGRADVRWVALQDADGF
GLFASAYGESPPMQVSASYYGAAELDRATHNHKLVKGDDIEVHLDHKHMGLGGDDSWSPC
VHEQYLLPPARYAFSVRLCPLLPSSSCHDIYHSQLPC
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagcttctgccagtgcactgttttccgccaagaatcttccgcataaaccctgg
gaggacccgtcattctttaggtggagaaagcgggaggctcatgtgccgttgcgctcacat
gacacacctgaaggagccctcaagtattggcatgaacggaggaatgtgaactatcttaat
tctgactctgctgtttggaatgatgacgcggttcgtggtgccctggaaagtgctgcgttt
tggtccaagggcttgccatatgtccagactctaagtggatactggaagttccttttggct
tcctcgccagaatctgttccagagaaattctatgatgcctacttcaatgattcagattgg
gaggctttgccagttccctcaaactggcaaatgcatgggtttgaccgtccaatctacaca
aatgtcacttatcctttcaccatgaacccgccatttgtgccaaatgataatcctactggc
tgttataggacggtttttcgcatcccaaaagagtggaaaggtcgaagaatcttgttgcac
tttgaagctgttgattcagcgttttttgcttgggtaaacggcgttcctgttggatatagc
caggacagcaggcttcctgctgagtttgagatcacagatttctgccatccttgtgactca
gaaaaggaaaatgttcttgctgttcaagtgatgaggtggagtgacggttcctatcttgaa
gaccaggaccattggtggctatctggtattcacagggatgttctactagtatcaaagcca
cagatctttattacagattattttttcaaagcaaccttggatgaaggcttccgtgtagct
gatattgaggttgaggtggaaattgactcacaaaagcaggatcgggagcatgtctcaact
ttgtctattgaagcaacattgtatgacaattatggacctgctgatgttttaacttctgat
atgtctgctgctagtgtggccaatttgaagttgaagccagcttcaagaccaaaacactgt
tatggttttcatggttatgttcttggtggaaaagtagaaaatccaaaactttggtctagt
gaacatcccaacttatacactcttgttgttgtccttaaagattccaacgggaagctcatt
gagtgtgaatcatgccaagtaggaatccgtaatgtcgtcctggcacacaagcagatgctt
gtcaatggatgtcctgttgtaataagaggtgtcaacagacatgagcatcatccacgtgtt
ggaaagacaaatttagaagcttgcatgattaaggatctggttttgatgagacaaaacaac
attaatgctgttagaaacagccattatccccaacatccaaggtggtatgagctgtgtgac
atttttggactttatgtaattgatgaagccaacatcgagacgcatggctttgatgaatct
agccatttcaaacatcctacacttgaacccttctgggcaagtgctatgcttgatcgtgtt
gttggtatggtggagagagacaagaatcatgcatgcattatagtatggtccttgggaaat
gaatcttcgtatggaccaaatcactcagccatgtctggctggattcgtggaaaggacccg
acaaggcccatccattatgaaggaggtggttctagaacatcctccactgatattgtatgc
ccaatgtacatgcgtgtctgggatattcttaagatcgcacaagacccttctgaaaatagg
cccctcattctttgcgaatattcacatgctatgggaaacagtaatggaaatattgatgca
tattggatggccatagacaacactgttggactccaaggtggttttatatgggactgggtc
gatcagggtttactaaaggaagatgctgatggatctaaaaactgggcatatggtggcgac
tttggagacactccaaatgacttgaatttttgtcttaatggcattgtatggcctgatcgg
acaattcacccagctgtgcatgaagttaaatatttataccagcctatcaaaataacaatg
atggataacatgcttaagattgaaaacgtacatttttttgagacaacagaagctttggac
ttcagttggctacttcaaggagatggctgtgctttgggctctggttcacttaatgtccca
tccatagcaccacagagtactcatctgatcaatatgaagtcatcaccttggtttactatt
tggagtacttgtgtcgtaaaagaaatatttttgtccattaacgtgaaattgaggtaccaa
acacaatgggccaaagatggccatatcttggcttcagcacaaatttgtttacctccgaaa
aaaggctttgtccctcatgcgatagcactgcccaggagctctttggtttcggaacgtgtt
ggtgatcatgtactcatcagcaaaagtaatgcctggcaaatcaaagtaaacagtatttca
ggaacaatcgatagttggaaggtcaacaacattgagcttatgagcaagggaatacaccca
tgcttttggcgaacaccaactgacaacgacaagggaggcttctacaccaagccctatgtt
tcaagatggagagaagcttctctcgacaacatctcgttctacagcagccagttttctctg
aaggaattgccagaccaaaccgtcgagatctccaccatctactacggtcttcctgggaat
caaccaaagcctgatgaaacctctctctcagacgaatccgagtccgtcctcttccgggtg
cagatgcgcggccggatctacgactccggcgacgtgatcctggactacgaggtgagcccc
aagaacgacctgcctcctcttcctcgcgtcggcgtcgtgttcaacgccgacaagtccctg
agccgtgcaaaatggtacgggagggggccattcgagtgctacccggaccggaaggccgcc
gcgcacgtcggcgtgtacgagagcggcgtcgacgagctgcacgtgccgtacattgtcccc
ggcgagtgcggcggccgggctgacgtccggtgggtggcgctccaggacgccgacgggttc
ggcctcttcgcgtcggcctacggcgagtcgccgccgatgcaggtgagcgccagctactat
ggcgccgcggagctcgaccgcgcgacgcataaccacaagctcgtcaagggagacgacatc
gaggtgcatcttgatcacaagcacatggggctgggaggggacgacagctggtcgccgtgc
gtgcacgagcagtacttgctgccgccggcgagatacgccttctcggtgaggctgtgcccg
ttgctgccgtcgtcgtcgtgccatgacatctaccactctcagctaccctgttga

DBGET integrated database retrieval system