KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326153Help
Entry
4326153           CDS       T01015                                 

Definition
Os01g0106900
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4326153
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     4326153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 473 aa AA seqDB search
MALKVVSFPGDLAAVSFLDSNRGGAFNQLKVDLPFQTRDRRAVSLRRTCCSMQQAPPPAW
PGRAVVEPGRRSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ
VKTFKPKLVAVRNESLVDELKEALADCDWKPEIIPGEQGVIEVARHPDAVTVVTGIVGCA
GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAQKHKVKILPADSEHSAIFQCIQGLPE
GALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA
HYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEV
TWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVELFIDEKIG
YLDIFKVVELTCDAHRNELVTRPSLEEIIHYDLWAREYAASLQPSTGLSPVPV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaggtcgtctctttccccggggacttggccgcggtctcattcctcgactcc
aacagaggaggagctttcaaccagctcaaagtggacctcccgtttcaaacgagggacaga
agagcagtttccctgagaaggacttgctgttcaatgcaacaggctccaccaccagcatgg
cctggtcgagccgttgttgaacctgggaggaggtcatgggatggccccaagcctatctca
attgttggctcaaccggttctattggcacacagacattggacatagttgcggagaatcca
gataaattccgggttgttgctcttgctgctggctccaatgtgactcttctagctgatcag
gtgaaaacattcaaaccaaagcttgttgctgtaagaaatgagtcattagttgatgagcta
aaggaagccttagctgattgtgattggaagccagaaattattcctggtgagcaaggtgtc
atagaggttgctcgccacccagatgcagttacagttgttactgggatagtagggtgtgca
ggactgaagcctacagttgctgcaattgaagctgggaaagatatagcattggcgaacaaa
gagacacttattgcaggtggtccttttgtgcttccccttgcacaaaagcacaaagtgaaa
atacttcctgctgattctgagcactctgctatatttcagtgtatacaaggcttgcccgaa
ggagcacttcgccgcattattttgactgcatcaggtggtgctttcagggactggccagtt
gacaagttgaaagaagtaaaagttgctgatgctttaaagcacccgaactggaatatgggg
aagaagattactgtagattctgctacattattcaacaagggtttagaagttattgaagca
cattatttatttggtgctgaatacgatgacattgaaattgtgatccacccacaatctatc
atacactctatgattgaaacccaggattcatctgtgttggctcaactgggatggccagat
atgcggataccaatcttatacaccatgtcttggccagacagaatctattgctcagaggtc
acctggccccgactagatctttgcaagctgggttcactgacattcaaagctcctgacaat
gtgaaatacccgtcgatggatctcgcctatgcagctggaagagctgggggcaccatgaca
ggagttctgagtgctgctaatgagaaggctgtggagttgttcatcgatgaaaagatcggg
tacctggacatcttcaaggtggtggagctgacatgcgacgctcatcggaatgagctagta
acaaggccatcactggaggagatcatacattatgatctgtgggcgagggagtatgctgcc
agcctacagccatccactggcctcagccctgtacctgtctag

DBGET integrated database retrieval system