KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326473Help
Entry
4326473           CDS       T01015                                 

Definition
Os01g0349400
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    4326473
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4326473
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     4326473
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     4326473
Spliceosome [BR:osa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    4326473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 325 aa AA seqDB search
MMMTRASMGAMEGAAVDEVVRRLVEGGRGGRQVQLSEAEIRQLCVEAKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPTSTYLFLGDYVDRGKQSLETICLLLAYKVKYP
DKIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFCDCFNCLPMAALIDDKILCMHGG
LSPELNSLDQIKDIERPTEIPDYGLLCDLVWSDPSPDSEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNAGALLSIDESLMCSFQI
LKPNDTGAPHSRKPTSNKTPKTGNA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggcgtcgatgggggcgatggaaggcgcggcggtggacgaggtggtg
cggcgcctcgtggagggcgggcgcggggggaggcaggtgcagctgtcggaggcggagatc
cggcagctctgcgtcgaggcgaagcgggtgctcctgtcgcagccgaacctcctgcgcatc
cacgcccccgtcaagatctgcggtgatatccatgggcaatttgttgatcttctgaggctg
tttgatttgggcggttatcctccaacttccacttatcttttccttggagattatgtggac
agaggcaaacaaagcttggaaaccatatgcttgcttctggcatacaaagtgaagtatcct
gataagattttcctgttaaggggaaaccatgaagatgcgaaaattaacagagtgtatggt
ttctatgatgaatgtaagaggcgattcaatgttcgactgtggaagattttctgtgattgc
ttcaactgcttgcctatggcagcactcattgacgataagatactctgcatgcatggtggc
ctctcacctgaactgaatagcttggatcaaataaaggatatcgagaggcccactgagatt
cctgactatggtcttttgtgtgatttagtttggtctgatcctagtcctgactcagaaggg
tggggagagagtgacagaggtgtttcctgcacttttggtgcagataagcttgtagaattt
ttggagaagaatgatcttgatcttatatgccgcgctcatcaggttgttgaggatggctac
gagttctttgcgcaaaggagattagtgacaatcttttcagctccaaactattgtggggaa
tttgataatgcgggtgctctgttgagcatagatgaaagtttaatgtgttcttttcaaatc
ttgaagccaaatgatacaggggctccacattcaaggaaaccaacttcaaacaagacccca
aaaactggaaacgcttaa

DBGET integrated database retrieval system