KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326473Help
Entry
4326473           CDS       T01015                                 

Definition
Os01g0349400
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:osa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 325 aa AA seqDB search
MMMTRASMGAMEGAAVDEVVRRLVEGGRGGRQVQLSEAEIRQLCVEAKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPTSTYLFLGDYVDRGKQSLETICLLLAYKVKYP
DKIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFCDCFNCLPMAALIDDKILCMHGG
LSPELNSLDQIKDIERPTEIPDYGLLCDLVWSDPSPDSEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNAGALLSIDESLMCSFQI
LKPNDTGAPHSRKPTSNKTPKTGNA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggcgtcgatgggggcgatggaaggcgcggcggtggacgaggtggtg
cggcgcctcgtggagggcgggcgcggggggaggcaggtgcagctgtcggaggcggagatc
cggcagctctgcgtcgaggcgaagcgggtgctcctgtcgcagccgaacctcctgcgcatc
cacgcccccgtcaagatctgcggtgatatccatgggcaatttgttgatcttctgaggctg
tttgatttgggcggttatcctccaacttccacttatcttttccttggagattatgtggac
agaggcaaacaaagcttggaaaccatatgcttgcttctggcatacaaagtgaagtatcct
gataagattttcctgttaaggggaaaccatgaagatgcgaaaattaacagagtgtatggt
ttctatgatgaatgtaagaggcgattcaatgttcgactgtggaagattttctgtgattgc
ttcaactgcttgcctatggcagcactcattgacgataagatactctgcatgcatggtggc
ctctcacctgaactgaatagcttggatcaaataaaggatatcgagaggcccactgagatt
cctgactatggtcttttgtgtgatttagtttggtctgatcctagtcctgactcagaaggg
tggggagagagtgacagaggtgtttcctgcacttttggtgcagataagcttgtagaattt
ttggagaagaatgatcttgatcttatatgccgcgctcatcaggttgttgaggatggctac
gagttctttgcgcaaaggagattagtgacaatcttttcagctccaaactattgtggggaa
tttgataatgcgggtgctctgttgagcatagatgaaagtttaatgtgttcttttcaaatc
ttgaagccaaatgatacaggggctccacattcaaggaaaccaacttcaaacaagacccca
aaaactggaaacgcttaa

DBGET integrated database retrieval system