KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326503Help
Entry
4326503           CDS       T01015                                 

Definition
Os01g0348600
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:osa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:osa00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:osa00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 727 aa AA seqDB search
MAAAAAAKGRTEMEVGADGVAVITICNPPVNSLSIDVLLSLKENYAEALRRNDVKAIVVT
GKGGKFSGGFDISSFGSVQGGKVEQPKVGYISIDIITDTLEAATKPSVAAIDGLALGGGL
EVAMACHARISTPTAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMMLLSKPIKGAEA
HQLGLVDSLVSADDLVNTARRWALDICELKRPWIKSLYKTDKLEPLGEAREILKFARAQA
RRQAANLEHPLVCIDVIEEGIVSGPRAGLWKEANAFQGLLFADTCKNLVHVFFSQRATSK
VPGATDLGLMPRKVTKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGIDRIKAN
LQSRVRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCP
SHCVLATNTSTIDLNLIGEKTRSKDRIVGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLD
VGKKIKKTPIVVGNCTGFAVNRMFFPYTQSALLFVDLGMDVYKIDRACTKFGMPMGPFRL
ADLVGFGVAAATGMQYLENFPERVYKSMLIPLMMEDKRTGEASRKGFYKYEDKRKATPDP
EIMKYIEKSRSMAGVTPDTELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIAS
IFGMGFPPYRGGIMFWADSIGAKYIHDKLEVWAKRYSDIFKPCSYLAERAANGVPLSAPA
KQVKARL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggcggcggcggcgaaggggaggacggagatggaggtcggagcggacggcgtc
gccgtcatcaccatctgcaacccgcccgtcaactcgctctccatcgatgtattgctaagc
ttaaaggaaaactatgctgaagctcttcggaggaatgatgtgaaagctattgttgttaca
gggaaaggaggaaaattttctggaggatttgatattagttcctttggtagtgttcagggt
ggcaaagttgaacagccaaaggttggttacatatcaatagatattatcactgatacccta
gaagctgcaacaaagccatcagtggctgcaattgatggtcttgctcttggtggaggattg
gaagttgctatggcatgccatgcacgcatttcaactcccacagctcaattaggacttcca
gaacttcaacttggagttattccaggatttggaggaacacaacgactcccgcgtcttgtt
ggattgacaaaagcacttgaaatgatgctgctatctaagccaattaagggtgcagaggca
caccaattgggtcttgttgattccttggtttctgctgatgatttggttaatactgctcgt
cgttgggctttggatatctgtgaattaaaaaggccatggatcaaaagtctttataagact
gacaaactagaaccacttggtgaggctagggagattctcaagtttgcaagagctcaagct
cgaaggcaggctgccaatcttgagcatccgcttgtttgtattgatgtcattgaagaaggt
attgtttcgggaccccgagctgggctctggaaggaagcaaatgctttccagggtcttctt
ttcgcggatacatgtaaaaacttagttcatgtattcttttctcaacgggcaacatcaaag
gttcctggtgctacagacttgggattgatgcctaggaaagttactaaagttgccattcta
ggtggtggacttatgggttcaggaattgcaactgcgatgatactgagtaattatcctgtt
atactcaaagaagtaaatgagaagtttctaaatgctggaattgacagaattaaagccaat
ttgcagagtcgtgtgaggaaagggaaaatgacagaggagagatatgagaaagccatgtct
cttgtaacaggtgtcctcgattatgaaaggttcaaagacgtggatttagttattgaggct
gttattgaaaatgtgaaattgaaacagcaaatattttctgacttggagaagtactgtcct
tcccattgtgtccttgctactaatacatctacaattgatcttaatctaattggtgagaaa
acaaggtccaaagaccgtattgtcggtgcacacttctttagccctgcacatgtcatgcca
cttctggaaatagtccgcacccagcacacctcaccacaagttgtcgttgatttgcttgat
gttgggaagaaaatcaagaagacaccaatagtggttgggaactgtaccggtttcgcagtc
aacagaatgttctttccttacactcagtcagcactcctgttcgttgatcttggtatggat
gtgtacaagatcgatcgtgcatgtaccaaatttggaatgcccatgggtccattcagactg
gcagacctcgttggttttggtgttgctgcggccactggtatgcagtaccttgagaacttc
ccagagagggtctacaagtcaatgttgattcctcttatgatggaggacaaaaggacaggt
gaggcctctcggaagggcttttacaagtatgaggacaagaggaaggcaactcctgatccc
gaaattatgaaatatattgaaaaatctaggagtatggctggagtaacaccagacactgag
ttgatgaagctaagtgagaaggacatagttgagatggtcttcttcccagtcataaatgag
gcttgccgtgttcttgatgagggaattgcagtcaaggcttctgaccttgacattgcctca
atctttggcatgggattcccaccgtataggggaggaatcatgttctgggcagattccatt
ggtgcaaagtacatccatgacaagttggaggtgtgggcgaagcggtatagcgacatcttc
aagccttgttcctaccttgcagaaagagcagcaaatggggttcctctgagtgcaccagct
aagcaagtcaaggcccgactatag

DBGET integrated database retrieval system