KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326603Help
Entry
4326603           CDS       T01015                                 

Definition
Os01g0634600
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:osa00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:osa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 325 aa AA seqDB search
MPMPLYGVVNSPCRSHCRAAATLLVSVSLLCSCFAIAMPSVVVTVDQSGKGDHRRIQDAI
DAAPANDSSRTVIRIKPGVYRRKVVVDKPYVTLTGTSATSTVIAWNESWVSDESPTVSVL
ASDFVAKRLTFQNTFGDSAPAVAVRVAGDRAAFYGCRFVSFQDTLLDETGRHYYRGCYVQ
GATDFIFGNGRALFDKCHLHSTSPDGAGGAFTAQQRSSESEETGYSFVGCKLTGLGAGTS
ILGRPWGPYSRVVFALTYMSSTVRPQGWDDWGDPSNQRTAFYGQYQCYGDGSKTDGRVAW
SHDLTQAEAAPFITKAWVDGQQWLR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgccgttatatggggtggtcaactcgccgtgccgcagccactgcagggccgcg
gcaacgttgttggtctcggtgtccctgctctgctcttgcttcgccatcgccatgccgagc
gtcgtcgtcacggtcgaccagtccggcaagggcgaccaccggaggatccaggacgcgatc
gatgccgccccggcaaacgactcctcccgcaccgtcatccggatcaagcccggggtttac
aggcgaaaggtcgtggtggacaagccgtacgtgacgctgaccggcacgagcgcgacctcg
acggtgatcgcctggaacgagtcgtgggtctccgacgagtcccccaccgtgtccgtgctg
gcctccgacttcgtcgccaagcgcctgacgtttcagaacacgttcggggacagcgcgccg
gcggtggcggtgagggtcgccggagacagggcggcgttctacgggtgcaggttcgtgtcg
ttccaggacacgctcctcgacgagacggggcggcactactaccgcggctgctacgtgcag
ggcgccaccgacttcatattcggaaacggccgggctctgtttgacaaatgccacctgcac
tccacgtcgcccgacggcgccggcggggcgttcacggcgcagcagcggtcgtcggaatcg
gaggagacggggtacagcttcgtggggtgcaagctgaccggcctcggcgccggcacctcc
atcctgggccggccgtgggggccatactcccgcgtcgtcttcgcgctcacctacatgtcc
tccaccgtcaggccccaaggctgggacgactggggcgacccctccaatcagcggacggcg
ttctatgggcagtaccagtgctacggcgacggatcgaagaccgacggcagggttgcctgg
tctcacgacctgacgcaggccgaggcggcgccgttcatcaccaaggcttgggttgatggg
cagcaatggcttcggtag

DBGET integrated database retrieval system