KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326798Help
Entry
4326798           CDS       T01015                                 

Definition
Os01g0338200
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    4326798
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     4326798
Peptidases [BR:osa01002]
 Metallo Peptidases
  Family M67
   4326798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 517 aa AA seqDB search
MGPPQQARGGGIDIEACARPIAVDHRIKLPYYFRIAGNLLRQAKIYRDENNLVDLYVILL
RYSSLVCETIPKHRDYHTFKLREVDFFRLAPHNQSKLIEVLSELESLKPVVQRQITEHNR
ARGGAIESNSINGTIAVNNITKQHMTNPYTYQPFVGSNNGSFERPVPGGNHQMAPLMSAQ
PDRLTRKQLANLPFPKEETLARHSILGPNGLHGQWTGPVTAIKVQYPSNLDIIKSDVSSL
FPSVLNQDGQNGPSTISTDSTQIENDDMKSVLSLDDGRWSKLAEECASVPSVSLEEELSQ
LSIKQPSPPPVLAELERRPIAPSEVADPTPGLAVSETGRYQNLHVPVKLMECFLRVAEAN
TKRSLETCGVLAGTLKKRTFYVTALIIPKQKSTSDSCEATNEDELFDVQDKGSLFTLGWI
HTHPTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTRRKHGIFHLSDPGGMGVIHDCP
ERGFHPHKAPLDGSPIYEHCSHVYMNPDVKFDVIDLR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggggccgccgcagcaggccaggggcggcggcatcgacatcgaggcgtgcgcgcgcccg
atcgccgtcgaccaccgcatcaagctcccctactacttccgcatcgccgggaacctcctc
cgccaggctaagatatatcgagacgagaataatctcgtcgacctgtatgtcatcctcctg
cgttactcgagcttggtttgcgagacgattccaaagcaccgtgactaccatacattcaag
ttgagagaagtggatttcttcaggcttgctccacataatcaatctaaactaattgaagtg
ctcagtgagcttgagtcactgaagccagttgtgcagcggcaaatcactgagcataacaga
gcaagaggaggtgccatcgaatccaatagtataaatggaaccattgctgtaaataatata
acaaaacagcatatgacaaatccttatacatatcagccatttgtaggaagcaacaatgga
tcatttgaaagacctgtccctggtgggaatcatcaaatggcaccattaatgagtgctcaa
cctgatagactgacccgcaaacaacttgcaaatctccctttccctaaagaagaaacatta
gctagacactctatattgggacctaatgggcttcatgggcaatggactgggcctgttact
gcaatcaaggttcagtatccaagcaatcttgatataataaaaagcgatgtgtctagttta
tttccatctgtcttgaaccaagatggtcagaatggtcccagtacaatatccacagatagc
actcaaattgagaatgatgatatgaaatctgttctgtcccttgatgatggtcgatggtct
aagctggcagaggaatgcgcctctgtaccttctgttagtctggaagaagaattatcccaa
ttgagtatcaaacagccttcacctcctccagtcttggcagagttagagcgcaggccaatt
gctccatcagaagttgcagatccaacaccaggacttgctgtctcagaaaccgggcgttat
cagaacttacatgttccggtaaagttgatggaatgttttctaagggttgctgaggcaaac
actaagagaagtttagaaacatgtggagttcttgctggtaccctgaaaaagagaaccttt
tatgtgactgccttgataattccaaagcagaaatctacatctgattcatgtgaagcgaca
aatgaagatgaattatttgatgttcaggacaagggctcgcttttcactcttggttggatt
cacacacatccaacacagtcctgcttcctgtcttccattgatctccataatcattattct
tatcaggtgatgttacctgaagcaattgcaatagttatggcacctactgacacaagaaga
aaacatggtatatttcatctctctgatcctggcggtatgggtgtgatccatgattgcccg
gagagaggattccatcctcataaggcccctctagatggttcaccaatttatgagcattgc
tcccatgtgtatatgaaccccgatgtaaagtttgatgtgattgaccttcgataa

DBGET integrated database retrieval system