KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326798Help
Entry
4326798           CDS       T01015                                 

Definition
Os01g0338200
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:osa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 517 aa AA seqDB search
MGPPQQARGGGIDIEACARPIAVDHRIKLPYYFRIAGNLLRQAKIYRDENNLVDLYVILL
RYSSLVCETIPKHRDYHTFKLREVDFFRLAPHNQSKLIEVLSELESLKPVVQRQITEHNR
ARGGAIESNSINGTIAVNNITKQHMTNPYTYQPFVGSNNGSFERPVPGGNHQMAPLMSAQ
PDRLTRKQLANLPFPKEETLARHSILGPNGLHGQWTGPVTAIKVQYPSNLDIIKSDVSSL
FPSVLNQDGQNGPSTISTDSTQIENDDMKSVLSLDDGRWSKLAEECASVPSVSLEEELSQ
LSIKQPSPPPVLAELERRPIAPSEVADPTPGLAVSETGRYQNLHVPVKLMECFLRVAEAN
TKRSLETCGVLAGTLKKRTFYVTALIIPKQKSTSDSCEATNEDELFDVQDKGSLFTLGWI
HTHPTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTRRKHGIFHLSDPGGMGVIHDCP
ERGFHPHKAPLDGSPIYEHCSHVYMNPDVKFDVIDLR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggggccgccgcagcaggccaggggcggcggcatcgacatcgaggcgtgcgcgcgcccg
atcgccgtcgaccaccgcatcaagctcccctactacttccgcatcgccgggaacctcctc
cgccaggctaagatatatcgagacgagaataatctcgtcgacctgtatgtcatcctcctg
cgttactcgagcttggtttgcgagacgattccaaagcaccgtgactaccatacattcaag
ttgagagaagtggatttcttcaggcttgctccacataatcaatctaaactaattgaagtg
ctcagtgagcttgagtcactgaagccagttgtgcagcggcaaatcactgagcataacaga
gcaagaggaggtgccatcgaatccaatagtataaatggaaccattgctgtaaataatata
acaaaacagcatatgacaaatccttatacatatcagccatttgtaggaagcaacaatgga
tcatttgaaagacctgtccctggtgggaatcatcaaatggcaccattaatgagtgctcaa
cctgatagactgacccgcaaacaacttgcaaatctccctttccctaaagaagaaacatta
gctagacactctatattgggacctaatgggcttcatgggcaatggactgggcctgttact
gcaatcaaggttcagtatccaagcaatcttgatataataaaaagcgatgtgtctagttta
tttccatctgtcttgaaccaagatggtcagaatggtcccagtacaatatccacagatagc
actcaaattgagaatgatgatatgaaatctgttctgtcccttgatgatggtcgatggtct
aagctggcagaggaatgcgcctctgtaccttctgttagtctggaagaagaattatcccaa
ttgagtatcaaacagccttcacctcctccagtcttggcagagttagagcgcaggccaatt
gctccatcagaagttgcagatccaacaccaggacttgctgtctcagaaaccgggcgttat
cagaacttacatgttccggtaaagttgatggaatgttttctaagggttgctgaggcaaac
actaagagaagtttagaaacatgtggagttcttgctggtaccctgaaaaagagaaccttt
tatgtgactgccttgataattccaaagcagaaatctacatctgattcatgtgaagcgaca
aatgaagatgaattatttgatgttcaggacaagggctcgcttttcactcttggttggatt
cacacacatccaacacagtcctgcttcctgtcttccattgatctccataatcattattct
tatcaggtgatgttacctgaagcaattgcaatagttatggcacctactgacacaagaaga
aaacatggtatatttcatctctctgatcctggcggtatgggtgtgatccatgattgcccg
gagagaggattccatcctcataaggcccctctagatggttcaccaatttatgagcattgc
tcccatgtgtatatgaaccccgatgtaaagtttgatgtgattgaccttcgataa

DBGET integrated database retrieval system