KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326806Help
Entry
4326806           CDS       T01015                                 

Gene name
OsJ_01619, OsPDIL2-2, OsPDIL4-2, PDIL2-2, PDIL4-2
Definition
(RefSeq) protein disulfide isomerase-like 2-2
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4326806 (OsJ_01619)
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4326806 (OsJ_01619)
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4326806 (OsJ_01619)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 371 aa AA seqDB search
MAIPRISPRKTLPLFAALALALAWAFAAPAFADGDDVVALTESTFEKEVGQDRGALVEFY
APWCGHCKKLAPEYEKLGASFKKAKSVFIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSL
EPKKYEGQRSAEALAEFVNTEGGTNVKLATIPSSVVVLGPDNFDSIVLDENKDILVEFYA
PWCGHCKHLAPIYEKLASVYKLDDGVVIANLDADKHKDLAEKYGVSGYPTLKFFPKGNKA
GEDYDGGRELDDFVKFINEKCGTSRDTKGQLTSEAGRIASLDALAKEFLGAANDKRKEIL
SNMEEEVVKLSGSAAKHGKVYIAIAKKILDKGHDYTKKETERLERMLEKSISPSKADEFI
IKKNVLSTFSS
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcccccgcatctcgccgcgcaaaaccctgcccctcttcgccgccctggccctg
gccttggcctgggccttcgccgccccggcgttcgccgacggcgacgacgtcgtcgccctc
acggagtccaccttcgagaaggaggtcggccaggaccgcggcgccctcgtcgagttctac
gcgccctggtgtggtcactgcaagaagcttgcccctgagtatgaaaagcttggtgcaagt
ttcaagaaagccaaatctgtctttattgcaaaggttgattgcgatgagcacaagagtgtg
tgcagcaagtatggagtttctgggtacccaacaattcaatggttccccaaaggatccctg
gagcccaaaaagtatgaaggacaacgcagtgcagaggcccttgctgaatttgttaacact
gaaggaggcactaatgtaaagctggcaaccattccttcaagtgttgtagtgcttggccca
gacaactttgactcaattgttcttgatgaaaacaaagacattcttgtggagttctatgcg
ccatggtgtggccactgcaagcatcttgctccgatatatgagaagctggcttctgtttat
aagttggacgatggagttgtaattgctaaccttgatgctgacaaacacaaagacttggcc
gaaaaatatggagtttctggctatcctacattgaagttcttcccaaagggaaacaaagct
ggtgaagattacgatggcggcagggagttggatgactttgtcaagttcattaatgagaag
tgtggtaccagccgtgatactaagggccaacttacttcagaggcggggcgcatagcaagt
ttggatgccctcgcaaaggagttccttggtgctgccaatgacaagcggaaggaaatcctc
tccaatatggaagaggaggttgtgaagctcagtggttctgctgcaaagcatggaaaggtc
tacattgccattgcaaagaaaatcctggacaaaggtcacgactataccaagaaggaaaca
gagaggcttgaacgcatgttggagaagtccatcagcccatcaaaggccgatgaattcatc
atcaagaagaacgtcctttcaaccttctcttcctaa

DBGET integrated database retrieval system