KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326855Help
Entry
4326855           CDS       T01015                                 

Definition
Os01g0665400
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    4326855
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     4326855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 367 aa AA seqDB search
MPTLDARLRLPLAGLSPATTSFPGSTPKPGSLSFALRPPSASLSSSASAPAAAAPPIVVV
GSANADIYVEVDRLPLVGETVAARAGRSLAGGKGANQAACGGRLAAGPTYLVARVGDDAN
GRLLEGALADAGGVRLDRVARAPGAPSGHAVVMLMPGGQNSIIIVGGANMEGWASGVGSD
DLDLIRRAGVLLLQREIPDWVNVQVAQAAKGAGVPVILDAGGMDAPVPGELLSLVDIFSP
NETELARLTGMPTETFEQISRAAGACHKMGVKEVLVKLGSQGSALFIEGGEPIRQPIIPA
TEVVDTTGAGDTFTSAFAVALVEGKPKEECMRFAAAAASLCVQVKGAIPSMPDRKSVMDL
LESVQVE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcctactctcgacgctcgcctccgcctccctctcgccggactatcgccggcgacgacc
tccttcccgggatccacccccaagccgggcagcctctcgttcgccctcaggccgccctcc
gcctccctgtcatcctccgccagtgccccggcggcggcggcgccgcccatcgtcgtcgtg
ggctccgccaacgccgacatctacgtcgaggtcgaccgcctcccgctcgtcggggagacg
gtggcggcgcgcgccggccgcagcctcgcgggcgggaagggcgccaaccaggccgcctgc
gggggccgcctcgcggcggggcccacctacctcgtggcgcgcgtcggggacgacgccaac
gggcggctcctcgagggcgccctcgcggacgccggcggcgtccgcctagaccgcgtcgcg
cgcgcgcccggcgcgccctcgggccacgccgtggtgatgctgatgcccggcgggcagaac
tccatcatcatcgtcggcggcgccaacatggaggggtgggcctcgggggtcggctcggac
gacctggacctgatccgccgggctggcgtgctgctgctgcagcgggagatacccgattgg
gtcaacgtgcaggttgcgcaggcagcaaaaggtgcaggtgtgcctgttatcttggacgcc
ggtggaatggatgctcctgtccctggggaactactgagcctggtggatatttttagtcca
aatgaaacagagcttgcacgtttgactgggatgcctacagaaacatttgaacagatcagt
cgagctgcaggagcatgccataaaatgggtgtgaaagaagtgctggttaaactcggatca
caaggatctgctttatttattgaagggggggagccgatcaggcagccgataattcctgcc
acagaagttgttgatacgactggtgccggtgacactttcacctcagcttttgctgtagct
ctagttgagggtaaacctaaggaagagtgcatgagatttgctgctgctgctgcatctcta
tgtgttcaagtaaagggagccatacccagcatgcctgaccgaaaatcagtaatggacctt
ctggaatctgttcaggttgaataa

DBGET integrated database retrieval system