KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327131Help
Entry
4327131           CDS       T01015                                 

Definition
Os01g0175000
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:osa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 301 aa AA seqDB search
RRPPASRSRRIRIHSALADLVAGRRITTDTSPHRRRRELGGGASVAARGRGGAAAAAIVR
GMSSFGGTSSVASGGGKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLP
NIKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDVEGLDASAAHVANLLSTEPADI
KLGVGGFSMGAATALYSATCYAHGKYGNGNPYPVNLSVSVGLSGWLPCARSLKNKIESSQ
EAAQKASSIPLLLCHGKADDVVLYKHGEKSADALKTTGFSNVVFKSYNRLGHYTVPNKIE
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
agaaggcccccagcgtcgcggagccgaaggatcaggattcactccgccctcgccgacctc
gtcgccggccgccgcatcaccaccgacacctccccccatcgccgccggcgagagttgggt
ggtggagcgagcgtggccgcgaggggacgcggaggggcggcggcggcggcgattgttcgc
gggatgagcagcttcggcggcaccagctccgtcgcctccggtggtgggaagaggctcgag
tacgggcggacgcatgtcgtgaggcccaagggcgcgcacaaggccaccatcgtctggctc
cacggcctcggggacaacggagccagctggtctcaactactggaaacccttccccttccc
aatataaaatggatttgccccaccgcgcctacaaggccagtggcagtttttggtgggttc
ccatcaactgcatggtttgatgttgctgatctttcagaagacgctcctgatgatgttgag
gggttggatgcctcagctgcacatgttgcaaacttattatcaactgagccagctgacatc
aaacttggtgttggtggctttagcatgggcgcagctaccgccctttactctgcaacctgc
tatgctcatggaaaatacggaaatggcaatccatatcctgtgaacttaagtgtgtctgtt
ggtctcagtggctggcttccttgtgccaggtctttgaagaacaaaattgaaagctcacag
gaggctgcacaaaaggcttcatccatacctcttttgctttgtcatggaaaagctgatgat
gtagttctctacaagcatggtgagaaatctgctgacgcactgaagacaactggattttca
aatgtggtgttcaagtcctacaacagacttggacactacactgttccaaacaaaattgag
aggtaa

DBGET integrated database retrieval system