KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327164Help
Entry
4327164           CDS       T01015                                 

Definition
Os01g0658700
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:osa00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 314 aa AA seqDB search
MSMGHYSEQRPGFEVTKDWNGADQVMIRSPRGASVLVSLHGGQVVSWRNDRGEELLFTSS
KAIFKPPKAMRGGIPICFPQFGNCGTLEQHGFARNRLWAIDDEAPPLNHNDNNGKVSVDL
LLKPSEDDLKCWPHCFEFRLRVSLSTDGDLSLVSRVRNVNGKPFSFSFAYHTYLSVSDIS
EVRIEGLETLDYLDNLSQRERFTEQGDAITFESEVDRVYVGSPSVIAVLDHEKKRTFIVR
KEGLPDVVVWNPWDKKSKTMADFGDEEYKQMLCVDAAAVERAITLKPGEEWTGKLELSAV
ASTNCSDHLDYPCS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggggcattactccgagcagaggccggggttcgaggtgaccaaggactggaac
ggcgccgaccaggtcatgatccggtcgccgcggggggcgtccgtcctggtcagcctgcac
ggcgggcaggtcgtctcctggaggaacgaccgcggcgaggagctcctcttcaccagcagc
aaggctatcttcaagccaccaaaagcgatgcgaggtggaattcccatatgctttccacag
tttggaaattgtggaacattggagcagcatggatttgcaaggaacaggctatgggccata
gatgatgaggctccaccactaaatcataatgataacaacggcaaagtttctgttgacctt
ctgttaaagccatctgaagatgatctcaaatgttggccacactgctttgaattccgtctc
agagtttctctttcgacggatggagatctctcgttagtatcacgagtcaggaatgttaat
gggaagccattcagtttttcgtttgcttaccatacatatctttcagtctctgacatcagt
gaggtgagaatagaaggtctggagacacttgattatcttgacaaccttagccaaagagaa
cgttttacagaacaaggagatgctataacatttgagtctgaggttgacagagtctacgtt
ggttccccaagcgtaattgctgtgcttgaccatgagaagaaacgcaccttcattgtaagg
aaagaagggcttcctgacgtcgttgtttggaacccatgggacaagaagtcgaaaacgatg
gcggattttggcgacgaggagtacaagcagatgctgtgtgtggacgctgccgcagtcgag
cgagccatcacgctgaagccaggcgaggagtggacggggaagctggagctgtccgccgtc
gcttccaccaactgcagcgaccatctggactacccttgtagctag

DBGET integrated database retrieval system