KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327285Help
Entry
4327285           CDS       T01015                                 

Definition
(RefSeq) pectinesterase
  KO
K01051  
pectinesterase [EC:3.1.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4327285
   00500 Starch and sucrose metabolism
    4327285
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     4327285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 584 aa AA seqDB search
MPPLHAGRPGPLLVLLAVTLAAAAATAVGASSDTAPFYPSAEEAAAAHCEGTLYPELCLS
TLADIPDLHTKSLPDVICGTVNRTKDAVAATSYNCSHYINSKYLTPRDRLAISDCMELLD
TTMDELQATTSDLESPAVAGGNNGSASMAAKRVTMDHVMTELSAAMTNQYTCLDGFDYKD
GERVRHYMESSIHHVSRMVSNSLAMAKKLPGAGGGGMTPSSSSPDTATQSESSETTQRQP
FMGYGQMANGFPKWVRPGDRRLLQAPASSITPDAVVAKDGSGGYTTVSAAVAAAPANSNK
RYVIHIKAGAYMENVEVGKSKKNLMFIGDGIGKTVIKASRNVVDGSTTFRSATVAVVGNN
FLARDLTIENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGT
IDFIFGNSAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAV
QSSFKTYLGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGAST
SNRVKWKGYRVITSASEASTFTVGNFIDGDVWLAGTSVPFTVGL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgccacccttacatgccgggagaccggggcctctgctcgtgctcctcgccgtcacactc
gccgccgccgccgccaccgccgtgggtgcgtcgtccgacacggcccccttctacccgtcc
gcggaggaggccgccgccgcgcactgcgagggcacgctctacccggagctctgcctgtcc
acgctcgccgacatcccggacctccacaccaagtccctcccggacgtcatctgcggcacc
gtcaaccgcaccaaggacgccgtcgccgccacctcctacaactgctcgcactacatcaac
agcaagtacctcacgccgcgcgaccgcctcgccatctccgactgcatggagctcctcgac
accaccatggacgagctccaggccaccaccagcgacctcgagtcgccggccgtcgccggc
ggcaacaatggctcggcctcgatggccgccaagcgcgtcaccatggaccacgtcatgacg
gagctctccgccgccatgaccaaccagtacacctgcctcgacggcttcgactacaaggac
ggggagagggtgcgtcattacatggagtccagcatccaccacgtctcccgcatggtcagc
aactcgctcgccatggccaagaagctgcccggcgccggcggcggtgggatgaccccgtca
tcgtcgtcgcccgacacggcgacgcaatcggagtcgtcagagaccacgcagcggcagcca
ttcatggggtacgggcagatggcgaatgggttcccgaagtgggtgaggccgggagaccgg
cggctactccaagcgccggcgtcgagcatcacgcccgacgcggtggtggcgaaggacggg
agcggcgggtacacgacggtgtcggcggcggtggcggcggcgccggcgaactcgaacaag
aggtacgtgatacacatcaaggccggggcgtacatggagaacgtggaggtggggaagagc
aagaagaacctgatgttcatcggcgacggcatcggcaagaccgtcatcaaggccagccgc
aacgtcgtcgacggctccaccaccttccgctccgccacagtcgctgtggtgggcaacaac
ttcctggcccgcgacctgacgatcgagaactcggccggcccgtcgaagcaccaggcggtg
gcgctgcgcgtgggcgccgacctgtcggcgttctaccggtgcagcttcgtcggctaccag
gacaccctctacgtccactccctccgccagttcttccgcgagtgcgacatctacggcacc
atcgacttcatcttcggcaactccgccgtcgtcttccagagctgcaacctctacgcgcgc
cgcccgctccccaaccagagcaacgtctacaccgcgcaggggcgggaggaccccaaccag
aacaccggcatctccatccagaagtgcaaggtggccgccgcctccgacctcctcgccgtc
cagtccagcttcaagacctacctcggccgcccctggaagcagtactcccgcacggtgttc
atgcagtcggagctcgacagcgtcgtcaaccccgccgggtggctcgagtggagcggcaac
ttcgcgctcgacacgctctactacggcgagtaccagaacaccggccccggggcctccacg
tccaaccgggtcaagtggaagggctaccgcgtcatcaccagcgcgtcggaggcgagcacc
ttcaccgtcggcaacttcatcgacggcgacgtatggctcgccggcacgtccgtccccttc
accgtcgggctgtga

DBGET integrated database retrieval system