KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327301Help
Entry
4327301           CDS       T01015                                 

Gene name
P0671B11.3
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327301 (P0671B11.3)
   00030 Pentose phosphate pathway
    4327301 (P0671B11.3)
   00051 Fructose and mannose metabolism
    4327301 (P0671B11.3)
   00052 Galactose metabolism
    4327301 (P0671B11.3)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    4327301 (P0671B11.3)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4327301 (P0671B11.3)
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4327301 (P0671B11.3)
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4327301 (P0671B11.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1
AA seq 531 aa AA seqDB search
MEAVGVAPAPAGVPEKKLLEVKESRKAAPAAPSTSMAAKWAMKKKLVGGDAGYVLEDVPH
LTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTSARGTHFRRAGPRQRV
YFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGIEGGYKGFYSRNTVALT
PKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGINQVYIIGGDGTQKGASVIYEEVRR
RGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGVVKLMGR
NSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDNGHMVIVVAEGAGQDL
IAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITLKYIDPTYMIRAVRSNA
SDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEKQNKVVITDRMWARVLC
STNQPCFLSHEDVEHLKHDDDEHHLHNTQLLEGESSPVKDSSKCNGTAAPV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtcggcgtggctccggcccccgcgggggtgccggagaagaagctgctcgaa
gtgaaggagtcccggaaggcggcgccggcggcgccgtcgacgtcgatggcggccaagtgg
gcgatgaagaagaagctcgtcggcggcgacgccgggtacgtgctcgaggacgtgccccac
ctcacggactacctgcccgagcttccgacttacccgaatcctctgcaagacaacccggct
tattcagtcgtcaagcaatacttcgtcaacactgacgacaccgtcacgcaaaagatcgtt
gttcataagaccagtgctaggggcacccatttccggcgagccgggccgcggcagcgggtg
tacttccagtccgatgaggtcaacgcggccattgtcacctgcggtggcctctgccctgga
cttaacactgttatccgcgagcttgtgtgcggcttgtatgatatgtatggcgtcaccagc
gtcgttggcatagagggtggatacaagggtttctattctagaaacaccgtcgcactgaca
ccgaaatcggtgaatgacatccacaagagaggtgggactgttcttggaacctccagagga
ggccatgacaccggcaaaatagttgacagtattaaggatcgcggtattaaccaggtgtat
attattggaggtgatggtacccagaaaggtgcttccgtaatttatgaggaagttcggagg
cgaggcctcaaatgttctgtggttggtgtcccaaagaccatagataacgacattgcggtg
atcgacaagtcctttggttttgacactgcggtggaggaggctcagagggccatcaatgct
gctcatgttgaggctgagagtgcagagaatggcattggtgttgtgaaactaatggggcgc
aacagtgggttcatcgcaatgtatgctactctggctagtcgcgatgtggattgttgctta
atcccagagtctccattctatctagaaggaaaaggtggactccttgaattcatcgagaaa
cggctcaaggacaatggccatatggtcattgtagtggctgagggtgctgggcaagatctc
attgcgaaaagcatgaattttgtggatactcaagatgcttctggaaataagctacttctg
gatgttggcctttggctctcccagaagatcaaggatcatttcaagaagaagcgcaacttc
cccatcactctcaagtacatcgacccgacatacatgatccgtgccgtcaggtcaaacgca
tccgacaacgtctactgcaccctgctagctcacagcgccctccacggcgccatggcgggg
tacaccggcttcaccgtcgcgccggtcaacggcaggcacgcgtatatcccgttctacaga
atcacggagaagcagaacaaggtggtgatcacggacaggatgtgggcgagggtgctgtgc
tcgacgaaccagccatgcttcctgagccacgaggacgtcgagcacctcaagcacgacgac
gacgagcaccacctgcacaacacgcagctcctcgaaggcgagagctcgccggtgaaggac
tcctccaagtgcaacgggacagcagcgccagtgtga

DBGET integrated database retrieval system