KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327304Help
Entry
4327304           CDS       T01015                                 

Definition
(RefSeq) zinc finger CCCH domain-containing protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 4327304
NCBI-ProteinID: XP_015621800
UniProt: Q9FU27 B7EQW0
Position
1
AA seq 386 aa AA seqDB search
MMMMGEGVSSVPPWSHLPVSGVDVLGGGGGGGDEMTPYVIAALRDYLPANDVGVGADEEE
EAAAMAAAVDAYACDEFRMYEFKVRRCARGRSHDWTECPFAHPGEKARRRDPRKYHYSGT
ACPDFRKGGCKRGDACEYAHGVFECWLHPARYRTQPCKDGTACRRRVCFFAHTPDQLRVL
PAQQSSPRSVASSPLAESYDGSPLRRQAFESYLTKTIMSSSPTSTLMSPPKSPPSESPPL
SPDGAAAIRRGSWPGVGSPVNDVLASFRQLRLNKVKSSPSGGWSYPSSSAVYGSPKAATG
LYSLPTTPLASTATVTTASSFMPNLEPLDLGLIGDEEPVQRVESGRALREKVFERLSRDG
AISGDATAFATAGVGLDVDWVSDLIN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgggggaaggagtcagcagcgtcccgccgtggtctcacctccccgtgagc
ggagtcgatgtactcggcggcggtggtggcggtggggatgagatgacgccgtacgtgatc
gccgcgctgcgggattacctgccggcgaatgatgtcggggtgggggctgacgaggaggag
gaggccgcggcgatggccgcggcggtggacgcgtacgcgtgcgacgagttccggatgtac
gagttcaaggtgcggcggtgcgcgcgcgggcggagccatgactggaccgagtgccccttc
gcgcacccgggggagaaggcgcgccgccgcgatccgcgcaagtaccactactccggcacc
gcgtgcccggacttccgcaagggcgggtgcaagcgcggcgacgcctgcgagtacgcccac
ggcgtgtttgagtgttggctccacccggcgcgctaccgcacccagccgtgcaaggacggc
accgcctgccgccgccgcgtctgcttcttcgcccacaccccggaccagctccgcgtcctc
ccggcgcagcagtccagccccaggagcgtggcgtcctcgccgctggccgagtcctacgac
ggctcgccgctgcgccgccaggcgttcgagagctacctcaccaagaccatcatgtcctcg
tccccgaccagcaccctcatgtctccgcccaagtcgcccccgtcggagtccccgccattg
tcgcccgacggtgccgcggccatccgtcgcggatcttggcccggcgtcggctcgccggtg
aacgacgtcctggcctcgttccgccagctccgcctcaacaaggtgaagtcgtcgccgtcc
ggcgggtggagctacccttcgtcgtccgccgtctacgggtctcccaaggccgccaccggc
ctctacagcctccccaccactccactggcttccacggcaacggtgaccaccgcctccagc
ttcatgcccaacctggagccactggacctcgggctcatcggcgacgaggagccggtccag
agggtggagtccggaagagccctccgggagaaggtgttcgagcgactgagccgggatggt
gccatctccggcgacgccacagccttcgccaccgccggtgttggcctcgacgttgattgg
gtgtccgacctcatcaactga

DBGET integrated database retrieval system