KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327372Help
Entry
4327372           CDS       T01015                                 

Definition
Os01g0837900
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 434 aa AA seqDB search
MEAQWLAEYPHQGADKRPRKRPRLAWDVAPPLFQPPKAIPMLYCGQELINGNFATAFLPP
PPIYYTGPPRNLSPPWRPDDKDGHYVFAVGENLTPRYRILSKMGEGTFGQVLECWDLEHQ
ETVAIKIVRSLQKYREAAMIEIDVLQRLGKHDFTGSRCVQIRNWFDYRNHICIVFERLGP
SLYDFLRKNSYRAFPIDLVREFARQILESVAFMHDLRLIHTDLKPENILLVSSESIRVPD
YKVTIRPPKDGSFFKNLPKSSAIKLIDFGSTTFEHQDHNYVVSTRHYRAPEVILGLGWNY
SCDLWSVGCILVELCSGEALFQTHENLEHLAMMERVLGPLPKHMIVRADRRAEKYFRRGL
RLDWPEGAASRESLKAVWKLPRLQNLVMQHVDHSAGDLIDLLQGLLRYDPDARLKAREAL
QHPFFTRCHRRCGY
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgcagtggctcgccgagtacccgcaccagggcgccgacaagcggccgcggaag
cggccccgcctcgcctgggatgtcgcgcccccgctgttccagccccccaaggcaattcct
atgctatattgcgggcaggaactaatcaatggaaattttgcgaccgcttttctgccaccg
ccaccaatctattatacaggaccaccacgcaatctttcgcctccctggaggccagatgac
aaggatggacactatgttttcgcagttggggagaaccttacaccaagatatagaatactt
agcaagatgggtgaagggacttttggacaagtcttagagtgctgggacttggaacaccaa
gagacagtggctatcaaaattgtgcgctcccttcagaaatatcgagaggctgctatgatt
gaaattgatgtgcttcagaggcttgggaagcatgattttactggtagccgctgtgtgcaa
atacggaattggtttgactatcgtaatcatatatgtatagtatttgagaggctcggacca
agcttatatgacttcctccgaaagaatagttatcgtgcatttccgatcgaccttgttcgg
gaatttgccagacaaatattagagtctgttgcatttatgcatgacctgcgacttattcac
acagatctgaaacctgagaacattctccttgtttcatcagaatctatccgggtgcctgat
tataaggttacaatacggcccccaaaggatggttccttttttaagaatcttccaaaatct
agtgctatcaagctgattgattttggaagtacaacattcgaacaccaagaccacaattat
gtggtatcaacaaggcattatcgtgcccctgaagttatccttggtcttgggtggaattat
tcatgtgatttgtggagtgtgggatgcattttagttgaactctgctcgggtgaagctctc
tttcaaacacatgaaaatttggagcatttggctatgatggagagagttctaggtcccctt
ccaaaacatatgattgtcagagctgatcgccgtgctgaaaagtatttcagacgtggatta
aggttggactggccagagggggctgcctcacgggaaagcctgaaggcagtctggaaattg
cctcgtctgcagaatctggtaatgcaacatgttgatcattctgctggagatcttatagat
cttcttcaaggccttcttcggtatgatcctgatgcgcgcctaaaggcacgtgaagctctt
caacacccgttctttacaagatgccacagaagatgtggttactga

DBGET integrated database retrieval system