KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327400Help
Entry
4327400           CDS       T01015                                 

Definition
(RefSeq) Os01g0841600
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4327400
   01230 Biosynthesis of amino acids
    4327400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4327400
   00051 Fructose and mannose metabolism
    4327400
   00562 Inositol phosphate metabolism
    4327400
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4327400
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4327400
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4327400
  Exosomal proteins of bladder cancer cells
   4327400
  Exosomal proteins of melanoma cells
   4327400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 255 aa AA seqDB search
MAARKFFVGGNWKCNGTGEDVKKIVTVLNEAEVPSEDVVEVVVSPPFVFLPQVKGLLRPD
FSVAAQNCWVRKGGAFTGEISAEMLVNLQVPWVILGHSERRALMGESSDFVADKIAYALS
QGIKVIACIGETLEQREAGTTMEVVAAQTKAIAEKISDWTNVVLAYEPVWAIGTGKVATP
AQAQEVHDGLRKWLVTNVSPAVAESTRIIYRGSVNGANCKELAAKPDVDGFLVGGASLKP
EFVDIIKSATVKSSA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaggaagttcttcgtcggcggcaactggaaatgcaatgggacaggggaggac
gtgaagaagatcgtcaccgtcctcaacgaggccgaggtgccctccgaggacgtcgtcgag
gtggtggtgagcccgccgttcgtgttcctgccgcaggtgaagggtttgctccggccggac
ttctccgtcgccgcgcagaattgctgggtgcgcaagggcggcgccttcactggcgagatc
agtgccgagatgttggtgaacctgcaggtgccttgggtgattctgggacactctgagcgg
agagcgctgatgggcgaatcaagtgattttgttgctgacaaaattgcgtacgcactttcc
caaggtatcaaggtaattgcttgcattggtgagacccttgaacagagagaagcaggaaca
acgatggaagttgttgcagcgcaaactaaagctattgcagagaagatatccgattggacc
aatgttgttttggcatatgaaccagtttgggccattggaaccggcaaggttgcaacccct
gctcaggctcaggaggttcatgatggtctgagaaagtggcttgtgactaatgttagtcct
gcagttgctgaatcaaccaggattatttacagaggctccgtaaatggagcaaactgcaaa
gaacttgctgctaaacctgatgttgatggattccttgttggaggagcttcattgaagcct
gaatttgtggacatcatcaagtctgctaccgtcaagtcttctgcttag

DBGET integrated database retrieval system