KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327845Help
Entry
4327845           CDS       T01015                                 

Definition
Os01g0782200
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    4327845
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     4327845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 507 aa AA seqDB search
MGDHRATAKVRVNGAPAEATLFCTDPPGAANGGGGDGGELRWRCAGGAAAERVLSLDADV
LGVEARGKEVVVKAFVLPADAAARSVSCAAGAGKGGGGRRRRRRDYVFEMAAGEDAAAAW
CDRMRGSLDSLGRPKRLFILVNPFGGKKCGKKIYEAEIKPLFEAAGVNVTMQETRYQGHA
RQVASSLDLARYDGIVCVSGDGVLVEVVNGILQRMDWEEAMKIPIGVVPAGTGNGMAKSL
LHSASKTYSVPNAVFAIIRGYSQSLDVCTIVQGRKKFFSVLNMTWGLVADIDIESEKYRW
MGSARFDFYALVRIMNLRKYYGSIQYVPAPGYEAYGDVVKQVENCTVECQEQIGKSLCSY
QGPSVEFQGSEWRSLDGPFVSIWINNVQWAAESIMAAPGAKFSDGYMDAVIVRDCPKADL
LALLMKMGDGSHVKSPYVTYLKVRCLRLSPGQLVENPKRGGIIDVDGEAIARGEGTYGKN
QKQDVMGYGPSIQMTVHRALATMYCPK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccaccgcgccacggccaaggtccgcgtgaacggcgcgccggcagaagcgacg
ctcttctgcaccgacccgccgggtgcagctaatggcggcggcggagatggaggggagctc
cggtggcggtgcgctggtggcgccgcggcggagcgcgtgctgtcgctggacgcggacgtg
ctcggggtcgaggccaggggtaaggaggtggtcgtgaaggccttcgtgctgccggcggac
gcggcggccaggtcggtgtcctgcgccgcgggtgcggggaagggaggaggaggacggagg
aggcgcaggagggattacgtgttcgagatggccgccggcgaggacgccgccgcggcctgg
tgcgacaggatgaggggctccctggactctctcggccggcctaagagattgttcatcctg
gtcaaccccttcggcggcaaaaaatgcggaaagaagatttacgaggcagagatcaagccc
ctgttcgaggccgccggtgtcaacgtcacaatgcaagagacccggtatcaggggcacgcc
cggcaggtggcgtcttctcttgaccttgcgcgctacgatggcattgtctgtgtcagcggc
gatggtgtcctcgtggaggtagtaaatggaattctacaacgaatggattgggaggaagcg
atgaagataccgattggggtggttccagcaggtacaggaaatggcatggctaaatcgctg
ttgcattctgccagtaagacatactcggttccaaatgccgtatttgccattatcagaggt
tacagtcagtccttggatgtatgcaccattgtgcagggaaggaagaaatttttcagtgtc
ttgaatatgacttggggtttggtggctgatatagatattgagtctgagaagtacaggtgg
atgggaagtgcacgctttgatttctatgctttggttcgcataatgaacttgagaaaatac
tacggaagtattcagtatgttcctgcccccggctatgaggcatatggagatgtcgtcaag
caggttgagaattgcactgtagaatgccaagaacagattgggaagtctttgtgttcttat
caaggtccttccgttgagtttcaaggttcagaatggagatcccttgatggtccatttgtg
tctatttggatcaacaacgtgcaatgggctgctgagagtatcatggcagctcctggggcc
aagttctcagatggctacatggatgcagtcatagtcagggactgtccaaaggctgatctt
ttagccctactgatgaagatgggcgatgggagtcatgtaaaatcaccatacgttacgtat
ctaaaggtgagatgtcttcggttatcaccaggccagcttgtggagaatccaaaacgaggt
ggcataatagacgtggacggggaggctatcgctagaggagaaggaacgtacggcaaaaac
cagaaacaggacgtgatgggttatggcccttccattcagatgacagtgcaccgagcgttg
gccacaatgtattgtcccaaatga

DBGET integrated database retrieval system