KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327918Help
Entry
4327918           CDS       T01015                                 

Definition
Os01g0286600
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4327918
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     4327918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 536 aa AA seqDB search
MAAAAAAMATATSATAAPPLRIRDAARRTRRRGHVRCAVASGAAEAPAAPGARVSADCVV
VGGGISGLCTAQALATKHGVGDVLVTEARARPGGNITTAERAGEGYLWEEGPNSFQPSDP
VLTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPGDLPFFDLMSIPGKLRAGLGAL
GVRAPPPGREESVEDFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEDT
GGSIIGGTIKTIQERGKNPKPPRDPRLPTPKGQTVASFRKGLTMLPDAITSRLGSKVKLS
WKLTSITKSDNKGYALVYETPEGVVSVQAKTVVMTIPSYVASDILRPLSSDAADALSIFY
YPPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRV
LLLNYIGGSTNTGIVSKTESELVEAVDRDLRKMLINPKAVDPLVLGVRVWPQAIPQFLIG
HLDHLEAAKSALGKGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDYLTKYAYK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgccgcagccatggccaccgccacctccgccacggcagcgccgccgctc
cgcattcgcgacgccgcgaggaggacccgccgacgcggccacgttcgctgcgccgtcgcc
agcggcgcggccgaggcgcccgcggcgcccggggcgcgggtgtcggcggactgcgtcgtg
gtgggcggcggcatcagcgggctctgcaccgcgcaggcgctggccacaaagcacggcgtc
ggcgacgtgctcgtcacggaggcccgcgcccgccccggcggcaacatcaccaccgccgag
cgcgccggcgagggctacctctgggaggaggggcccaacagcttccagccttccgacccc
gtcctcaccatggccgtggacagcgggctcaaggacgatctcgtgttcggggaccccaac
gcgccgcggttcgtgctgtgggaggggaagctaaggccggtgccgtccaagcccggcgac
ctgccgttcttcgacctcatgagcatccccggcaagctcagggccggccttggcgcgctc
ggcgttcgagcgccacctccagggcgtgaggagtcggtggaggacttcgtgcggcgcaac
ctcggcgcggaggtctttgagcgcctcattgagcctttctgctcaggtgtgtatgctggt
gatccttcaaagctcagtatgaaggctgcatttgggaaggtgtggaggctggaggatact
ggaggtagcattattggtggaaccatcaaaacaatccaggagagggggaaaaaccccaaa
ccgccgagggatccccgccttccaacgccaaaggggcagacagttgcatctttcaggaag
ggtctgactatgctcccggatgctattacatctaggttgggtagcaaagtcaaactttca
tggaagttgacaagcattacaaagtcagacaacaaaggatatgcattagtgtatgaaaca
ccagaaggggtggtctcggtgcaagctaaaactgttgtcatgaccatcccatcatatgtt
gctagtgatatcttgcggccactttcaagtgatgcagcagatgctctgtcaatattctat
tatccaccagttgctgctgtaactgtttcatatccaaaagaagcaattagaaaagaatgc
ttaattgacggagagctccagggtttcggccagctgcatccgcgtagtcagggagttgag
actttaggaacaatatatagctcatcactctttccaaatcgtgctccagctggaagggtg
ttacttctgaactacataggaggttctacaaatacagggattgtttccaagactgaaagt
gagctggtagaagcagttgaccgtgacctcaggaagatgctgataaatcctaaagcagtg
gaccctttggtccttggcgtccgggtatggccacaagccataccacagttcctcattggc
catcttgatcatcttgaggctgcaaaatctgccctgggcaaaggtggttatgatggattg
ttcctcggagggaactatgttgcaggagttgccctgggccgatgcgttgaaggtgcatat
gagagtgcctcacaaatatctgactacttgaccaagtacgcctacaagtga

DBGET integrated database retrieval system