KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327968Help
Entry
4327968           CDS       T01015                                 

Definition
Os01g0802100
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:osa00900]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 401 aa AA seqDB search
MACSTHLLSQSLYPLNRANPAAARGHLRFQASPSVRLGSGTSRRRALGLRVAASAEQGRR
QVEVEYDLQAKFNKLADQIDQNAGITRLNLFSPCKINVFLRITGKRPDGFHDLASLFHVI
SLGDTIKFSLSPSKSKDRLSTNVAGVPVDESNLIIKALNLYRKKTGTDNFFWIHLDKKVP
TGAGLGGGSSNAATALWAANQFSGCIASEKELQEWSGEIGSDIPFFFSQGAAYCTGRGEI
VEDIRNPLPANLPMVLVKPPEACSTAEVYKRLRLEHTSQTDPLVLLKEITENGISQDACV
NDLEPPAFEVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVGIGSPDPPAFVYDDDDYK
DTFVSEACFLTRNENEWYREPISSKITSEEDLPPEVASVSD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctccacccacctcctgtcccagagcctctacccgctcaaccgcgctaacccg
gcagccgcgcgcgggcacctccggttccaggcttctcccagtgtgaggctcggctccggc
accagtcgccgccgggcgctgggcctgagagtcgccgcgtcggcggagcaagggaggagg
caagtggaggttgagtatgatctacaagcaaagttcaacaagctagcggaccaaattgac
cagaatgctgggattacacggctgaacctattctcaccttgcaaaattaatgtgttcttg
aggataacgggtaagagaccagatgggttccatgacctggcttctctgtttcatgtgata
agtttgggtgatactatcaaattctcattgtcaccaagtaagagcaaagatcgcttgtca
accaatgtagcaggtgtcccagttgatgaaagcaatttgatcatcaaggcactcaatctt
taccgcaagaaaactggaactgacaactttttttggattcatcttgataagaaggtccct
actggtgctggtcttggtggtggaagcagtaatgctgcaactgcgctgtgggccgccaac
cagtttagtggctgcattgcttcagaaaaggagcttcaggagtggtctggagagatagga
tcggatattcccttcttcttttcacaaggagcagcgtattgtaccggtagaggagagatt
gttgaagatattcggaatccattgccagcaaatttgccgatggtactagtaaagccacct
gaagcatgctcaacagctgaagtttacaagcggctcaggttagagcacacaagtcaaact
gatcccttggtattgctcaaggaaattactgaaaatgggatatcacaggatgcctgtgtt
aatgatctagaacctccagcatttgaggtgttgccatcactaaagaggttgaagaaacgt
ataattgctgctaaccggggagattatgatgctgtttttatgtcaggaagtggaagcaca
attgttgggattggttcaccagatccgcctgcatttgtgtatgatgatgatgactacaag
gatacttttgtgtcagaggcctgcttcctcactcgtaatgagaacgagtggtacagagaa
ccaatctcatcgaaaatcactagcgaggaagatttacctccggaggtagcatcagtttct
gactga

DBGET integrated database retrieval system