KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327968Help
Entry
4327968           CDS       T01015                                 

Definition
Os01g0802100
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4327968
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     4327968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 401 aa AA seqDB search
MACSTHLLSQSLYPLNRANPAAARGHLRFQASPSVRLGSGTSRRRALGLRVAASAEQGRR
QVEVEYDLQAKFNKLADQIDQNAGITRLNLFSPCKINVFLRITGKRPDGFHDLASLFHVI
SLGDTIKFSLSPSKSKDRLSTNVAGVPVDESNLIIKALNLYRKKTGTDNFFWIHLDKKVP
TGAGLGGGSSNAATALWAANQFSGCIASEKELQEWSGEIGSDIPFFFSQGAAYCTGRGEI
VEDIRNPLPANLPMVLVKPPEACSTAEVYKRLRLEHTSQTDPLVLLKEITENGISQDACV
NDLEPPAFEVLPSLKRLKKRIIAANRGDYDAVFMSGSGSTIVGIGSPDPPAFVYDDDDYK
DTFVSEACFLTRNENEWYREPISSKITSEEDLPPEVASVSD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctccacccacctcctgtcccagagcctctacccgctcaaccgcgctaacccg
gcagccgcgcgcgggcacctccggttccaggcttctcccagtgtgaggctcggctccggc
accagtcgccgccgggcgctgggcctgagagtcgccgcgtcggcggagcaagggaggagg
caagtggaggttgagtatgatctacaagcaaagttcaacaagctagcggaccaaattgac
cagaatgctgggattacacggctgaacctattctcaccttgcaaaattaatgtgttcttg
aggataacgggtaagagaccagatgggttccatgacctggcttctctgtttcatgtgata
agtttgggtgatactatcaaattctcattgtcaccaagtaagagcaaagatcgcttgtca
accaatgtagcaggtgtcccagttgatgaaagcaatttgatcatcaaggcactcaatctt
taccgcaagaaaactggaactgacaactttttttggattcatcttgataagaaggtccct
actggtgctggtcttggtggtggaagcagtaatgctgcaactgcgctgtgggccgccaac
cagtttagtggctgcattgcttcagaaaaggagcttcaggagtggtctggagagatagga
tcggatattcccttcttcttttcacaaggagcagcgtattgtaccggtagaggagagatt
gttgaagatattcggaatccattgccagcaaatttgccgatggtactagtaaagccacct
gaagcatgctcaacagctgaagtttacaagcggctcaggttagagcacacaagtcaaact
gatcccttggtattgctcaaggaaattactgaaaatgggatatcacaggatgcctgtgtt
aatgatctagaacctccagcatttgaggtgttgccatcactaaagaggttgaagaaacgt
ataattgctgctaaccggggagattatgatgctgtttttatgtcaggaagtggaagcaca
attgttgggattggttcaccagatccgcctgcatttgtgtatgatgatgatgactacaag
gatacttttgtgtcagaggcctgcttcctcactcgtaatgagaacgagtggtacagagaa
ccaatctcatcgaaaatcactagcgaggaagatttacctccggaggtagcatcagtttct
gactga

DBGET integrated database retrieval system