KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327971Help
Entry
4327971           CDS       T01015                                 

Definition
Os02g0100100
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4327971
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4327971
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4327971
  Exosomal proteins of colorectal cancer cells
   4327971
  Exosomal proteins of bladder cancer cells
   4327971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 563 aa AA seqDB search
MRSRSLLLVALATLLLHASASASDDDLDYLIDNADDIPANDPDGWLQEGSPDDDDDDDLF
HHGQAQDHPIDETHVFLLSAANFSDFLASHRHVMVEFYAPWCAHCQALAPDYAAAAADLS
PLAHQVALAKVDATEDTDLAQKYDVQGFPTILFFIDGVPKDYNGARTKEAIVSWVNKKLA
PGVQNITTVDEAEKILTGEDKAILAVLDSLSGAHSDEIAAASRLEDAINFYQTSNPDVAK
LFHLDPAAKRPSLVLLKKQEEEKLTFYDGPFKASAIADFVSANKLPLVNTLTQETAPSIF
DNPIKKQILLFVVANESSKFLPIFKEASKSFKGKLLFVFVERDNEEVGEPVANYFGITGQ
ETTVLAYTGNEDARNFFLDGEISVENIKRFAEDFLEEKLTPFYKSEPVPESNEGDVKIVV
GKNLDQIVLDESKDALLEIYAPWCGHCQELEPTYNKLGKHLRGIDSLVIAKMDGTANEHP
RAKPDGFPTILFYPAGKKSFEPITFEGDRTVVEMYKFIKKHASIPFKLKRPDSSATKTEK
DQSTASTNLRGERSSGTNFKDEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcccgatctctcctcctcgtcgccctcgccacccttcttctccacgcctccgcc
tccgcctccgacgacgacctcgactacctcatcgacaacgccgacgacatccccgccaac
gaccccgacggctggctccaggagggctcccccgacgacgacgacgacgacgacctcttc
caccatggccaggcccaggaccatcccatagatgagacccacgtcttcctcctctccgcc
gccaacttctccgacttcctcgcctcccaccgccatgtcatggtcgagttctacgccccc
tggtgcgcccattgccaggcgctcgccccagactacgccgccgccgccgccgacctctcc
cctcttgcccatcaagtcgccctcgccaaggtcgacgccaccgaggacactgatctcgcc
cagaagtacgacgtccagggcttccccaccatcctcttcttcatcgacggcgttcccaag
gactacaacggcgcaagaaccaaggaagccatcgtgtcgtgggtcaacaagaagctagct
cccggggtgcaaaacatcaccaccgtcgacgaggcggagaagatactcaccggggaggac
aaggccattcttgccgtcctcgactccctatcgggtgctcacagtgatgagattgctgct
gcttcgaggctggaagatgctatcaacttttaccagacttccaatcctgatgttgccaag
ctttttcaccttgacccagcggccaagcgcccgtccttagtcctgctcaagaaacaagag
gaggagaagttgaccttctatgatgggccattcaaagcatctgcaattgccgattttgta
tctgcaaacaagcttccgttggtcaacaccctcacacaggaaactgctccttccattttt
gacaatccaatcaagaagcagattttactatttgttgttgcaaacgaatcgtcgaaattt
ctgcccatctttaaggaagcatcaaaatcattcaaggggaagcttttgtttgtctttgtg
gagcgtgacaatgaggaagtaggtgaaccagttgccaactactttggtattactggacaa
gagaccacagttcttgcttacactgggaatgaagatgctaggaattttttccttgatggt
gaaatatcggtagagaatattaagagatttgctgaggatttcttagaggaaaagctcaca
ccgttctacaagtctgaacctgtacctgaatctaatgaaggagatgtcaaaattgttgtt
ggaaaaaacctagatcagattgttttggatgaatcaaaagatgcccttttggagatatat
gcaccatggtgtgggcattgtcaggaactggagcctacctacaacaagctaggaaagcat
ctccgtggcattgactcccttgtaatagctaaaatggatggcactgccaatgagcatcca
cgtgcaaagcctgatggattcccaacgatcctcttttatccagcaggaaagaaaagtttt
gagcctattacttttgagggggaccgtacggtggtggagatgtacaagtttatcaagaag
cacgctagcatccctttcaaactgaagcggccggattcgtcagcaacgaaaacagagaag
gatcagagcacagcttcaactaatttgaggggggagaggagttccggtacaaatttcaag
gatgagttgtag

DBGET integrated database retrieval system