KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328091Help
Entry
4328091           CDS       T01015                                 

Definition
Os02g0117700
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4328091
   00052 Galactose metabolism
    4328091
   00500 Starch and sucrose metabolism
    4328091
   00520 Amino sugar and nucleotide sugar metabolism
    4328091
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4328091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 467 aa AA seqDB search
MADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDT
LAAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYTNSNIEVHTFNQSQYPRVVADEFLPWPSKGKT
CKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTL
KVSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagctcgccaagctgcgtgaagccgtcgccggcctctcgcagatcagt
gacaacgagaagtccgggttcatcagcctcgtcgcccgctacctcagtggcgaggaggag
catgtggaatgggcaaagatccacacgccgacggacgaggtggtggtgccgtacgacacc
ctggcggcgccgccggaggacttggaggagaccaagaagctgctcaacaagctcgccgtg
ctcaagctcaacggcggcctcggcaccaccatgggatgcaccggaccaaaatcggtcatc
gaagtgcgcaacggattcacattcctcgacttgattgtgatccagatcgagtccctcaac
aagaagtatggcagcaatgtcccactgcttctgatgaactcattcaacacccatgaagac
accttgaagattgttgagaaatacaccaattcgaacattgaagtccatactttcaatcag
agccagtatcctcgtgtggtagccgatgagttcttgccatggccttccaaggggaagacc
tgcaaggatggctggtaccctcctggccatggtgatatcttcccatccctgatgaacagt
ggcaagcttgatttgttactttcacagggaaaggagtatgtgttcattgcaaactcagat
aacttgggtgctatagtggacatgaagatactgaaccatttgatccacaaacagaatgaa
tattgcatggaggttaccccgaaaactctggctgatgttaaaggtggcacactgatctca
tatgaagacaaggttcagctcctggagattgcacaagttcctgatgcacatgtgaatgaa
ttcaaatccatcgagaaattcaagatcttcaacacgaacaatctatgggtgaacttgaag
gctatcaagcgccttgttgaggctgatgcactaaagatggagatcattccaaaccctaag
gaagtggatggagttaaagttcttcagttggaaacagcagctggtgcagcaatcaggttc
tttgatcacgcaattggtatcaatgttccaaggtcccggttcctaccagtgaaggcaaca
tcagatttgcagctagtacagtctgatctatataccttggttgatggctttgttacacgc
aacccggccagaacaaacccatcgaatccctcaattgaactgggtccagagttcaagaag
gtcgggtgtttccttggtcgcttcaagtcaatccccagcattgttgagcttgacaccttg
aaggtttccggtgatgtttggtttggctctagcatcacattgaagggcaaggtgaccatc
acagcccaacctggtgtcaaactggaaatcccagatggagcagtgatcgagaacaaggat
atcaatggccccgaggacctttga

DBGET integrated database retrieval system