KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328091Help
Entry
4328091           CDS       T01015                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Module
osa_M00361  Nucleotide sugar biosynthesis, eukaryotes
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4328091
   00052 Galactose metabolism
    4328091
   00500 Starch and sucrose metabolism
    4328091
   00520 Amino sugar and nucleotide sugar metabolism
    4328091
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4328091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DUF1647
Motif
Other DBs
NCBI-GeneID: 4328091
NCBI-ProteinID: XP_015627275
UniProt: Q6ZGL5 A0A1L2JID0
Position
2
AA seq 467 aa AA seqDB search
MADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDT
LAAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYTNSNIEVHTFNQSQYPRVVADEFLPWPSKGKT
CKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTL
KVSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagaagctcgccaagctgcgtgaagccgtcgccggcctctcgcagatcagt
gacaacgagaagtccgggttcatcagcctcgtcgcccgctacctcagtggcgaggaggag
catgtggaatgggcaaagatccacacgccgacggacgaggtggtggtgccgtacgacacc
ctggcggcgccgccggaggacttggaggagaccaagaagctgctcaacaagctcgccgtg
ctcaagctcaacggcggcctcggcaccaccatgggatgcaccggaccaaaatcggtcatc
gaagtgcgcaacggattcacattcctcgacttgattgtgatccagatcgagtccctcaac
aagaagtatggcagcaatgtcccactgcttctgatgaactcattcaacacccatgaagac
accttgaagattgttgagaaatacaccaattcgaacattgaagtccatactttcaatcag
agccagtatcctcgtgtggtagccgatgagttcttgccatggccttccaaggggaagacc
tgcaaggatggctggtaccctcctggccatggtgatatcttcccatccctgatgaacagt
ggcaagcttgatttgttactttcacagggaaaggagtatgtgttcattgcaaactcagat
aacttgggtgctatagtggacatgaagatactgaaccatttgatccacaaacagaatgaa
tattgcatggaggttaccccgaaaactctggctgatgttaaaggtggcacactgatctca
tatgaagacaaggttcagctcctggagattgcacaagttcctgatgcacatgtgaatgaa
ttcaaatccatcgagaaattcaagatcttcaacacgaacaatctatgggtgaacttgaag
gctatcaagcgccttgttgaggctgatgcactaaagatggagatcattccaaaccctaag
gaagtggatggagttaaagttcttcagttggaaacagcagctggtgcagcaatcaggttc
tttgatcacgcaattggtatcaatgttccaaggtcccggttcctaccagtgaaggcaaca
tcagatttgcagctagtacagtctgatctatataccttggttgatggctttgttacacgc
aacccggccagaacaaacccatcgaatccctcaattgaactgggtccagagttcaagaag
gtcgggtgtttccttggtcgcttcaagtcaatccccagcattgttgagcttgacaccttg
aaggtttccggtgatgtttggtttggctctagcatcacattgaagggcaaggtgaccatc
acagcccaacctggtgtcaaactggaaatcccagatggagcagtgatcgagaacaaggat
atcaatggccccgaggacctttga

DBGET integrated database retrieval system