KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328129Help
Entry
4328129           CDS       T01015                                 

Definition
Os02g0122300
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4328129
Translation factors [BR:osa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    4328129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 231 aa AA seqDB search
MEDWDSEDFQPAVPSAKAEPLKSKWADEDVEEDDVKESWEEEEEEKPKPPPVEKTAPKPS
GKGAAKKGKQQASTSSEVVQDEALDDPALEKLRQQRLVEEADFKSTTELFGKKDGSEKSL
DTFIPKSESDFAEYAELIANKLRPYEKSFHYMGLLKNVMRLSMASLKGADAKDISSSIAA
IANEKIKAEKEAAAGKKKQGAKKKQLHIENKDDDFIPGKGNFDDPDEYDFM
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggaggactgggattctgaagactttcagcccgcagtgcctagtgcaaaagctgagccg
cttaaaagtaagtgggcagatgaagatgtggaagaagatgatgtaaaagaatcatgggaa
gaagaggaggaggagaaacctaaaccaccacctgtagaaaagactgcaccaaaacctagt
gggaaaggtgctgcgaagaaaggaaaacaacaagcatcaactagttctgaagtagttcaa
gatgaggctctggatgatcctgctctagagaaacttcgtcaacaaaggcttgtggaagaa
gctgactttaagtcaactacggaactttttggaaagaaggacggcagtgaaaagtcccta
gataccttcatcccaaagtctgagagtgactttgcggaatatgcagagcttattgcaaac
aaactgcgtccctatgagaaaagcttccactatatgggtctactcaagaatgtcatgaga
ctttccatggcatcattgaaaggtgcggatgcgaaagatatatcgtcctccattgcagca
attgctaatgaaaagatcaaggctgagaaagaagctgcagcaggcaaaaagaaacaaggg
gcaaaaaagaagcagctacacattgagaataaagacgatgatttcatccctggaaagggt
aattttgatgatccggatgagtacgatttcatgtga

DBGET integrated database retrieval system