KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328238Help
Entry
4328238           CDS       T01015                                 

Definition
Os02g0137500
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4328238
Transcription factors [BR:osa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    4328238
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    4328238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 92 aa AA seqDB search
MTLQLRKMLDLLVHASTCRSGSCQYPNCRKVKGLFRHGMQCKTRASGGCVLCKKMWYMLQ
LHARACRDSGCNVPRCRCVGASHFCSVTLPCA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcagctaaggaagatgcttgatcttctggtacatgcctcgacatgccgctct
ggcagttgtcaatacccaaactgccggaaagtcaagggactgtttcgtcatgggatgcag
tgcaaaacacgtgcttcaggagggtgtgttctttgcaagaaaatgtggtacatgctccag
ctccatgcccgagcttgcagggactcaggatgcaacgtgccgagatgcaggtgtgttggt
gcttctcacttttgttccgtcaccttgccttgtgcttga

DBGET integrated database retrieval system