KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328297Help
Entry
4328297           CDS       T01015                                 

Definition
Os02g0148100
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     4328297
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   4328297
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4328297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 370 aa AA seqDB search
MAIMVDPPNGMGNQGKYYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRETNEKVAI
KKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLKPGNLLVNANCDLKICDFGLA
RTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSESDLEFIDNPKARRYIKSLPYTPGVPLASMYPHAHPLAIDLLQKML
IFDPTKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENISADMIREMMWHEMLHYH
PEVVAAMSAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcg
atgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcga
ggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaata
aagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctg
aaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgcca
gtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctg
catcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttcttttt
cagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaa
cctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgca
cgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtataga
gctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgtt
ggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgccta
aatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttc
attgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgccc
ctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctc
atatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcc
cctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagac
gagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccac
cctgaagttgttgcagcaatgagtgcccgatga

DBGET integrated database retrieval system