KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328297Help
Entry
4328297           CDS       T01015                                 

Definition
Os02g0148100
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 370 aa AA seqDB search
MAIMVDPPNGMGNQGKYYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSINRETNEKVAI
KKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVHRRSFKDVYLVYELMDTDL
HQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLKPGNLLVNANCDLKICDFGLA
RTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSESDLEFIDNPKARRYIKSLPYTPGVPLASMYPHAHPLAIDLLQKML
IFDPTKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENISADMIREMMWHEMLHYH
PEVVAAMSAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcg
atgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcga
ggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaata
aagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctg
aaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgcca
gtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctg
catcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttcttttt
cagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaa
cctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgca
cgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtataga
gctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgtt
ggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgccta
aatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttc
attgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgccc
ctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctc
atatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcc
cctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagac
gagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccac
cctgaagttgttgcagcaatgagtgcccgatga

DBGET integrated database retrieval system