KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328505Help
Entry
4328505           CDS       T01015                                 

Definition
Os02g0180000
Orthology
K17499  
protein phosphatase 1G [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4328505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 362 aa AA seqDB search
MGIYLSTPKTDKFSEDGENDKLKLGLSSMQGWRANMEDAHSALLNLDNETSFFGVFDGHG
GRVVAKFCAKYLHSQVLRSEAYSAGDLGTAVHRAFFRMDEMMRGQRGWRELSALGDKINK
IGGMIEGLIWSPRGSDSNNGQDDWSFEEGPHSDFAGPTCGCTACVALIRNNQLVVANAGD
SRCVISRAGQAYNLSRDHKPELEAERDRIVKAGGFIHMGRINGSLNLTRAIGDMEFKQNK
FLPPEKQIVTANPDINVVELCDDDDFLVLACDGIWDCMSSQQLVDFIHEHIQKESSLSAV
CERVLDRCLAPSTIGGEGCDNMTMVLVQFKKPITQNKKADVGEQSVKGVEEAEINAAEEN
GS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggaatctacctcagtacccccaaaaccgataagttctctgaagacggggaaaatgat
aagcttaaacttggtctttcgtctatgcaaggatggcgtgcaaacatggaagatgctcat
tcagcattgctaaatcttgacaatgagacatcgttctttggtgtttttgatggccatgga
ggaagagtggttgccaaattctgtgcaaaatatttacactctcaagttctcagaagtgaa
gcctattcagctggtgacttaggcactgctgttcatagagctttcttcaggatggacgaa
atgatgcgaggacagagaggctggagagaactatctgcacttggagataagataaacaag
attggtggtatgattgaagggttgatttggtctccgagaggcagtgattcgaataatgga
caagatgattggtctttcgaagagggaccccactccgattttgctgggccaacatgcgga
tgcacagcatgtgtagcgctaataagaaataaccaacttgttgtggcgaacgctggtgat
tcccgttgtgttatttctagggctggccaggcatacaatttgtcaagagaccacaagcca
gagcttgaagctgagagagacagaatagtaaaagcagggggtttcattcatatgggacga
ataaatggaagtttaaacttgacaagagcaattggagatatggaatttaaacagaacaaa
ttcttgcctcctgagaagcaaatcgtgactgcaaatcctgacatcaacgttgttgagctt
tgcgacgacgacgactttcttgttttagcatgtgacggcatttgggactgcatgtcaagc
caacagctggtggatttcatccacgagcatatacagaaggagagcagtctttctgcagtg
tgcgaaagagtgctcgacagatgcctagctccatcaacaattggtggagagggatgtgac
aacatgaccatggttctggtgcagttcaaaaagcctattactcagaataaaaaagccgac
gtaggggagcaatctgtgaaaggtgtggaagaggctgagatcaatgctgctgaggagaat
ggttcttga

DBGET integrated database retrieval system